Recombinant Human PRG2 protein, His-GST-tagged
| Cat.No. : | PRG2-4492H |
| Product Overview : | Recombinant Human PRG2 protein(P13727)(17-104aa), fused to N-terminal His tag and GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST&His |
| Protein Length : | 17-104aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 41.2 kDa |
| AA Sequence : | LHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGC |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | PRG2 proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein) [ Homo sapiens ] |
| Official Symbol | PRG2 |
| Synonyms | PRG2; proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein); bone marrow proteoglycan; BMPG; MBP; bone-marrow proteoglycan; proteoglycan 2 preproprotein; natural killer cell activator; eosinophil major basic protein; eosinophil granule major basic protein; MBP1; MGC14537; |
| Gene ID | 5553 |
| mRNA Refseq | NM_001243245 |
| Protein Refseq | NP_001230174 |
| MIM | 605601 |
| UniProt ID | P13727 |
| ◆ Recombinant Proteins | ||
| PRG2-1749H | Recombinant Human PRG2 Protein, His-GST-tagged | +Inquiry |
| PRG2-44H | Recombinant Human PRG2, His-tagged | +Inquiry |
| PRG2-46H | Recombinant Human PRG2, StrepII-tagged | +Inquiry |
| Prg2-1747R | Recombinant Rat Prg2 protein, His & GST-tagged | +Inquiry |
| PRG2-45H | Recombinant Human PRG2, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRG2-2872HCL | Recombinant Human PRG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRG2 Products
Required fields are marked with *
My Review for All PRG2 Products
Required fields are marked with *
