Recombinant Human PRG2 protein, His-GST-tagged

Cat.No. : PRG2-4492H
Product Overview : Recombinant Human PRG2 protein(P13727)(17-104aa), fused to N-terminal His tag and GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST&His
Protein Length : 17-104aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 41.2 kDa
AA Sequence : LHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGC
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name PRG2 proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein) [ Homo sapiens ]
Official Symbol PRG2
Synonyms PRG2; proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein); bone marrow proteoglycan; BMPG; MBP; bone-marrow proteoglycan; proteoglycan 2 preproprotein; natural killer cell activator; eosinophil major basic protein; eosinophil granule major basic protein; MBP1; MGC14537;
Gene ID 5553
mRNA Refseq NM_001243245
Protein Refseq NP_001230174
MIM 605601
UniProt ID P13727

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRG2 Products

Required fields are marked with *

My Review for All PRG2 Products

Required fields are marked with *

0
cart-icon