Recombinant Human PRG2, His-tagged
Cat.No. : | PRG2-44H |
Product Overview : | Recombinant Human Bone Marrow Proteoglycan/BMPG is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Leu17-Tyr222) of Human PRG2 fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 17-222 a.a. |
Description : | Bone Marrow Proteoglycan (BMPG) is a secreted protein that contains one C-type lectin domain. BMPG is the predominant constituent of the crystalline core of the eosinophil granule. BMPG is highly expressed in placenta and pregnancy serum. BMPG may be involved in antiparasitic defense mechanisms as a cytotoxin and helminthotoxin. BMPG induces non-cytolytic histamine release from human basophils. In addition, BMPG also participated in antiparasitic defense mechanisms and immune hypersensitivity reactions. |
AA Sequence : | LHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKKDGAVESISVPD MVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQ CSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGYWRRAH CLRRLPFICSYVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Gene Name | PRG2 proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein) [ Homo sapiens ] |
Official Symbol | PRG2 |
Synonyms | PRG2; proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein); bone marrow proteoglycan; BMPG; MBP; bone-marrow proteoglycan; proteoglycan 2 preproprotein; natural killer cell activator; eosinophil major basic protein; eosinophil granule major basic protein; MBP1; MGC14537; |
Gene ID | 5553 |
mRNA Refseq | NM_001243245 |
Protein Refseq | NP_001230174 |
MIM | 605601 |
UniProt ID | P13727 |
Chromosome Location | 11q12 |
Pathway | Asthma, organism-specific biosystem; Asthma, conserved biosystem; |
Function | binding; heparin binding; sugar binding; |
◆ Recombinant Proteins | ||
PRG2-19H | Recombinant Human PRG2 Protein (Leu17-End), N-His-ABP tagged | +Inquiry |
PRG2-2390H | Recombinant Human PRG2 protein, His-SUMO-tagged | +Inquiry |
PRG2-45H | Recombinant Human PRG2, GST-tagged | +Inquiry |
PRG2-5978H | Recombinant Human PRG2 Protein (Thr106-Tyr222), N-His tagged | +Inquiry |
PRG2-13H | Recombinant Human PRG2 Protein (Leu17-End), N-His-ABP tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRG2-2872HCL | Recombinant Human PRG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRG2 Products
Required fields are marked with *
My Review for All PRG2 Products
Required fields are marked with *