Recombinant Human PRKAR2B protein, GST-tagged

• Cat.No.: PRKAR2B-301518H
• Product Overview: Recombinant Human PRKAR2B (1-122 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Pro122
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization
• AA Sequence: MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFCHEGRTWGDLGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAYNP
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: PRKAR2B protein kinase, cAMP-dependent, regulatory, type II, beta [ Homo sapiens ]
• Official Symbol: PRKAR2B
• Synonyms: PRKAR2B; protein kinase, cAMP-dependent, regulatory, type II, beta; PRKAR2; cAMP-dependent protein kinase type II-beta regulatory subunit; H_RG363E19.2; WUGSC:H_RG363E19.2; cAMP-dependent protein kinase type II-beta regulatory chain; RII-BETA
• Gene ID: 5577
• mRNA Refseq: NM_002736
• Protein Refseq: NP_002727
• MIM: 176912
• UniProt ID: P31323