Recombinant Human PRKAR2B protein, GST-tagged
| Cat.No. : | PRKAR2B-301518H |
| Product Overview : | Recombinant Human PRKAR2B (1-122 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Pro122 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization |
| AA Sequence : | MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFCHEGRTWGDLGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAYNP |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | PRKAR2B protein kinase, cAMP-dependent, regulatory, type II, beta [ Homo sapiens ] |
| Official Symbol | PRKAR2B |
| Synonyms | PRKAR2B; protein kinase, cAMP-dependent, regulatory, type II, beta; PRKAR2; cAMP-dependent protein kinase type II-beta regulatory subunit; H_RG363E19.2; WUGSC:H_RG363E19.2; cAMP-dependent protein kinase type II-beta regulatory chain; RII-BETA; |
| Gene ID | 5577 |
| mRNA Refseq | NM_002736 |
| Protein Refseq | NP_002727 |
| MIM | 176912 |
| UniProt ID | P31323 |
| ◆ Recombinant Proteins | ||
| Prkar2b-5117M | Recombinant Mouse Prkar2b Protein, Myc/DDK-tagged | +Inquiry |
| PRKAR2B-398H | Recombinant Human PRKAR2B Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| PRKAR2B-4335R | Recombinant Rat PRKAR2B Protein, His (Fc)-Avi-tagged | +Inquiry |
| PRKAR2B-4676R | Recombinant Rat PRKAR2B Protein | +Inquiry |
| PRKAR2B-1953H | Recombinant Human PRKAR2B protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRKAR2B-2860HCL | Recombinant Human PRKAR2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRKAR2B Products
Required fields are marked with *
My Review for All PRKAR2B Products
Required fields are marked with *
