Recombinant Human PRKAR2B protein, His-tagged
| Cat.No. : | PRKAR2B-1953H |
| Product Overview : | Recombinant Human PRKAR2B protein(1-122 aa), fused with His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-122 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFCHEGRTWGDLGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAYNP |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PRKAR2B protein kinase, cAMP-dependent, regulatory, type II, beta [ Homo sapiens ] |
| Official Symbol | PRKAR2B |
| Synonyms | PRKAR2B; protein kinase, cAMP-dependent, regulatory, type II, beta; PRKAR2; cAMP-dependent protein kinase type II-beta regulatory subunit; H_RG363E19.2; WUGSC:H_RG363E19.2; cAMP-dependent protein kinase type II-beta regulatory chain; RII-BETA; |
| Gene ID | 5577 |
| mRNA Refseq | NM_002736 |
| Protein Refseq | NP_002727 |
| MIM | 176912 |
| UniProt ID | P31323 |
| ◆ Recombinant Proteins | ||
| PRKAR2B-13360M | Recombinant Mouse PRKAR2B Protein | +Inquiry |
| PRKAR2B-1953H | Recombinant Human PRKAR2B protein, His-tagged | +Inquiry |
| Prkar2b-5117M | Recombinant Mouse Prkar2b Protein, Myc/DDK-tagged | +Inquiry |
| Prkar2b-609R | Recombinant Rat Prkar2b | +Inquiry |
| PRKAR2B-7091M | Recombinant Mouse PRKAR2B Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRKAR2B-2860HCL | Recombinant Human PRKAR2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRKAR2B Products
Required fields are marked with *
My Review for All PRKAR2B Products
Required fields are marked with *
