Recombinant Human PRKAR2B protein, His-tagged

Cat.No. : PRKAR2B-1953H
Product Overview : Recombinant Human PRKAR2B protein(1-122 aa), fused with His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-122 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFCHEGRTWGDLGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAYNP
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name PRKAR2B protein kinase, cAMP-dependent, regulatory, type II, beta [ Homo sapiens ]
Official Symbol PRKAR2B
Synonyms PRKAR2B; protein kinase, cAMP-dependent, regulatory, type II, beta; PRKAR2; cAMP-dependent protein kinase type II-beta regulatory subunit; H_RG363E19.2; WUGSC:H_RG363E19.2; cAMP-dependent protein kinase type II-beta regulatory chain; RII-BETA;
Gene ID 5577
mRNA Refseq NM_002736
Protein Refseq NP_002727
MIM 176912
UniProt ID P31323

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRKAR2B Products

Required fields are marked with *

My Review for All PRKAR2B Products

Required fields are marked with *

0
cart-icon