Recombinant Human PRKCQ protein, GST-tagged
| Cat.No. : | PRKCQ-301488H |
| Product Overview : | Recombinant Human PRKCQ protein(1-145 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | October 30, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 1-145 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MSPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTFDAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGKTEIWLELKPQGRMLMNARYFLEMSDTKDMNEFETEGFFALHQR |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | PRKCQ protein kinase C, theta [ Homo sapiens ] |
| Official Symbol | PRKCQ |
| Synonyms | PRKCQ; protein kinase C, theta; protein kinase C theta type; PRKCT; nPKC-theta; MGC126514; MGC141919; |
| mRNA Refseq | NM_001242413 |
| Protein Refseq | NP_001229342 |
| MIM | 600448 |
| UniProt ID | Q04759 |
| Gene ID | 5588 |
| ◆ Recombinant Proteins | ||
| PRKCQ-408H | Active Recombinant Full Length Human Protein Kinase C, Theta, GST-tagged | +Inquiry |
| PRKCQ-2704H | Recombinant Human PRKCQ protein, His & GST-tagged | +Inquiry |
| PRKCQ-3425R | Recombinant Rhesus Macaque PRKCQ Protein, His (Fc)-Avi-tagged | +Inquiry |
| PRKCQ-5522Z | Recombinant Zebrafish PRKCQ | +Inquiry |
| PRKCQ-30178TH | Recombinant Full Length Human PRKCQ Protein, GST tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRKCQ-1416HCL | Recombinant Human PRKCQ cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRKCQ Products
Required fields are marked with *
My Review for All PRKCQ Products
Required fields are marked with *
