Recombinant Human PRMT1 protein, T7/His-tagged

Cat.No. : PRMT1-123H
Product Overview : Recombinant human PRMT1 cDNA (371 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDM TSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSI SDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRAT LYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFC LQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDL DFTIDLDFKGQLCELSCSTDYRMR
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Publications :
Arginine Methylation of the PGC-1α C-Terminus Is Temperature-Dependent (2022)
Gene Name PRMT1 protein arginine methyltransferase 1 [ Homo sapiens ]
Official Symbol PRMT1
Synonyms PRMT1; protein arginine methyltransferase 1; HMT1 (hnRNP methyltransferase, S. cerevisiae) like 2 , HMT1 hnRNP methyltransferase like 2 (S. cerevisiae) , HRMT1L2; protein arginine N-methyltransferase 1; ANM1; HCP1; interferon receptor 1-bound protein 4; histone-arginine N-methyltransferase PRMT1; HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 2; heterogeneous nuclear ribonucleoprotein methyltransferase 1-like 2; IR1B4; HRMT1L2;
Gene ID 3276
mRNA Refseq NM_001207042
Protein Refseq NP_001193971
MIM 602950
UniProt ID Q99873
Chromosome Location 19q13
Pathway Androgen Receptor Signaling Pathway, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; Energy Metabolism, organism-specific biosystem; Tryptophan metabolism, organism-specific biosystem; mRNA processing, organism-specific biosystem;
Function N-methyltransferase activity; N-methyltransferase activity; histone methyltransferase activity; histone methyltransferase activity (H4-R3 specific); methyltransferase activity; protein binding; transferase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRMT1 Products

Required fields are marked with *

My Review for All PRMT1 Products

Required fields are marked with *

0
cart-icon
0
compare icon