Recombinant Full Length Human PRMT2 protein, GST-tagged

Cat.No. : PRMT2-12H
Product Overview : Recombinant Human PRMT2 fused with GST tag at N-terminal was expressed in Insect cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : GST
Protein Length : 1-433 a.a.
Description : PRMT2, protein arginine methyltransferase 2, arginine methyltransferase that methylates the guanidino nitrogens of arginyl residues in proteins such as STAT3, FBL, histone H4. PRMT2 acts as an ERα-binding protein and enhances both its AF-1 and AF-2 transcriptional activity. Inhibit NF-kappa-B transcription by blocking nuclear export of IkappaB-alpha through a leptomycin-sensitive pathway, increasing nuclear IkappaB-alpha and decreasing NF-kappaB DNA binding, which in turn renders cells susceptible to apoptosis.
Form : 50mM Tris-HCl, pH 7.5, 150mM NaCl, 10mM glutathione, 0.1mM EDTA, 0.25mM DTT, 0.1mM PMSF, 25% glycerol.
Molecular Mass : 76 kDa
AA Sequence : MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGC CGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGI ISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIES ILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCL SEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLF MMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR
Purity : >90%
Storage : Store product at –70 centigrade. For optimal storage, aliquot target into smaller quantities after centrifugation and store at recommended temperature. For most favorable performance, avoid repeated handling and multiple freeze/thaw cycles.
Concentration : 0.05μg/μl
Gene Name PRMT2 protein arginine methyltransferase 2 [ Homo sapiens ]
Official Symbol PRMT2
Synonyms PRMT2; protein arginine methyltransferase 2; HMT1 (hnRNP methyltransferase, S. cerevisiae) like 1 , HMT1 hnRNP methyltransferase like 1 (S. cerevisiae) , HRMT1L1; protein arginine N-methyltransferase 2; MGC111373; PRMT2 beta; PRMT2 alpha; PRMT2 gamma; HMT1 hnRNP methyltransferase-like 1; histone-arginine N-methyltransferase PRMT2; HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 1; HRMT1L1;
Gene ID 3275
mRNA Refseq NM_001242864
Protein Refseq NP_001229793
MIM 601961
UniProt ID P55345
Chromosome Location 21q22.3
Pathway mRNA processing, organism-specific biosystem;
Function androgen receptor binding; estrogen receptor binding; estrogen receptor binding; histone methyltransferase activity; histone-arginine N-methyltransferase activity; methyltransferase activity; peroxisome proliferator activated receptor binding; progesterone receptor binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRMT2 Products

Required fields are marked with *

My Review for All PRMT2 Products

Required fields are marked with *

0
cart-icon