Recombinant Full Length Human PRMT2 protein, GST-tagged
Cat.No. : | PRMT2-12H |
Product Overview : | Recombinant Human PRMT2 fused with GST tag at N-terminal was expressed in Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | GST |
Protein Length : | 1-433 a.a. |
Description : | PRMT2, protein arginine methyltransferase 2, arginine methyltransferase that methylates the guanidino nitrogens of arginyl residues in proteins such as STAT3, FBL, histone H4. PRMT2 acts as an ERα-binding protein and enhances both its AF-1 and AF-2 transcriptional activity. Inhibit NF-kappa-B transcription by blocking nuclear export of IkappaB-alpha through a leptomycin-sensitive pathway, increasing nuclear IkappaB-alpha and decreasing NF-kappaB DNA binding, which in turn renders cells susceptible to apoptosis. |
Form : | 50mM Tris-HCl, pH 7.5, 150mM NaCl, 10mM glutathione, 0.1mM EDTA, 0.25mM DTT, 0.1mM PMSF, 25% glycerol. |
Molecular Mass : | 76 kDa |
AA Sequence : | MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGC CGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGI ISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIES ILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCL SEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLF MMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR |
Purity : | >90% |
Storage : | Store product at –70 centigrade. For optimal storage, aliquot target into smaller quantities after centrifugation and store at recommended temperature. For most favorable performance, avoid repeated handling and multiple freeze/thaw cycles. |
Concentration : | 0.05μg/μl |
Gene Name | PRMT2 protein arginine methyltransferase 2 [ Homo sapiens ] |
Official Symbol | PRMT2 |
Synonyms | PRMT2; protein arginine methyltransferase 2; HMT1 (hnRNP methyltransferase, S. cerevisiae) like 1 , HMT1 hnRNP methyltransferase like 1 (S. cerevisiae) , HRMT1L1; protein arginine N-methyltransferase 2; MGC111373; PRMT2 beta; PRMT2 alpha; PRMT2 gamma; HMT1 hnRNP methyltransferase-like 1; histone-arginine N-methyltransferase PRMT2; HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 1; HRMT1L1; |
Gene ID | 3275 |
mRNA Refseq | NM_001242864 |
Protein Refseq | NP_001229793 |
MIM | 601961 |
UniProt ID | P55345 |
Chromosome Location | 21q22.3 |
Pathway | mRNA processing, organism-specific biosystem; |
Function | androgen receptor binding; estrogen receptor binding; estrogen receptor binding; histone methyltransferase activity; histone-arginine N-methyltransferase activity; methyltransferase activity; peroxisome proliferator activated receptor binding; progesterone receptor binding |
◆ Recombinant Proteins | ||
Prmt2-1170M | Recombinant Mouse Prmt2 Protein, MYC/DDK-tagged | +Inquiry |
PRMT2-02H | Recombinant Human PRMT2 Protein, transcript variant 1, C-Flag-tagged | +Inquiry |
PRMT2-5188H | Recombinant Human PRMT2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PRMT2-634HF | Recombinant Full Length Human PRMT2 Protein, GST-tagged | +Inquiry |
PRMT2-3431R | Recombinant Rhesus Macaque PRMT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRMT2-2839HCL | Recombinant Human PRMT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRMT2 Products
Required fields are marked with *
My Review for All PRMT2 Products
Required fields are marked with *