Recombinant Full Length Human PRMT2 protein, GST-tagged

• Cat.No.: PRMT2-12H
• Product Overview: Recombinant Human PRMT2 fused with GST tag at N-terminal was expressed in Insect cells.

Specification

• Species: Human
• Source: Insect Cells
• Tag: GST
• Protein Length: 1-433 a.a.
• Description: PRMT2, protein arginine methyltransferase 2, arginine methyltransferase that methylates the guanidino nitrogens of arginyl residues in proteins such as STAT3, FBL, histone H4. PRMT2 acts as an ERα-binding protein and enhances both its AF-1 and AF-2 transcriptional activity. Inhibit NF-kappa-B transcription by blocking nuclear export of IkappaB-alpha through a leptomycin-sensitive pathway, increasing nuclear IkappaB-alpha and decreasing NF-kappaB DNA binding, which in turn renders cells susceptible to apoptosis.
• Form: 50mM Tris-HCl, pH 7.5, 150mM NaCl, 10mM glutathione, 0.1mM EDTA, 0.25mM DTT, 0.1mM PMSF, 25% glycerol.
• Molecular Mass: 76 kDa
• AA Sequence: MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGC CGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGI ISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIES ILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCL SEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLF MMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR
• Purity: >90%
• Storage: Store product at –70 centigrade. For optimal storage, aliquot target into smaller quantities after centrifugation and store at recommended temperature. For most favorable performance, avoid repeated handling and multiple freeze/thaw cycles.
• Concentration: 0.05μg/μl

Gene Information

• Gene Name: PRMT2 protein arginine methyltransferase 2 [ Homo sapiens ]
• Official Symbol: PRMT2
• Synonyms: PRMT2; protein arginine methyltransferase 2; HMT1 (hnRNP methyltransferase, S. cerevisiae) like 1 , HMT1 hnRNP methyltransferase like 1 (S. cerevisiae) , HRMT1L1; protein arginine N-methyltransferase 2; MGC111373; PRMT2 beta; PRMT2 alpha; PRMT2 gamma; HMT1 hnRNP methyltransferase-like 1; histone-arginine N-methyltransferase PRMT2; HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 1; HRMT1L1
• Gene ID: 3275
• mRNA Refseq: NM_001242864
• Protein Refseq: NP_001229793
• MIM: 601961
• UniProt ID: P55345
• Chromosome Location: 21q22.3
• Pathway: mRNA processing, organism-specific biosystem
• Function: androgen receptor binding; estrogen receptor binding; estrogen receptor binding; histone methyltransferase activity; histone-arginine N-methyltransferase activity; methyltransferase activity; peroxisome proliferator activated receptor binding; progesterone receptor binding