"PRMT2" Related Products

Expand

Recombinant Human PRMT2 protein, GST-tagged

Cat.No.: PRMT2-12H
Product Overview: Recombinant Human PRMT2 fused with GST tag at N-terminal was expressed in Insect cells.
Description: PRMT2, protein arginine methyltransferase 2, arginine methyltransferase that methylates the guanidino nitrogens of arginyl residues in proteins such as STAT3, FBL, histone H4. PRMT2 acts as an ERα-binding protein and enhances both its AF-1 and AF-2 transcriptional activity. Inhibit NF-kappa-B transcription by blocking nuclear export of IkappaB-alpha through a leptomycin-sensitive pathway, increasing nuclear IkappaB-alpha and decreasing NF-kappaB DNA binding, which in turn renders cells susceptible to apoptosis.
Source: Insect cells
Species: Human
Tag: GST
Form: 50mM Tris-HCl, pH 7.5, 150mM NaCl, 10mM glutathione, 0.1mM EDTA, 0.25mM DTT, 0.1mM PMSF, 25% glycerol.
Molecular Mass: 76 kDa
AA Sequence: MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGC CGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGI ISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIES ILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCL SEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLF MMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR
Purity: >90%
Storage: Store product at –70 centigrade. For optimal storage, aliquot target into smaller quantities after centrifugation and store at recommended temperature. For most favorable performance, avoid repeated handling and multiple freeze/thaw cycles.
Concentration: 0.05μg/μl
Gene Name: PRMT2 protein arginine methyltransferase 2 [ Homo sapiens ]
Official Symbol: PRMT2
Synonyms: PRMT2; protein arginine methyltransferase 2; HMT1 (hnRNP methyltransferase, S. cerevisiae) like 1 , HMT1 hnRNP methyltransferase like 1 (S. cerevisiae) , HRMT1L1; protein arginine N-methyltransferase 2; MGC111373; PRMT2 beta; PRMT2 alpha; PRMT2 gamma; HMT1 hnRNP methyltransferase-like 1; histone-arginine N-methyltransferase PRMT2; HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 1; HRMT1L1;
Gene ID: 3275
mRNA Refseq: NM_001242864
Protein Refseq: NP_001229793
MIM: 601961
UniProt ID: P55345
Chromosome Location: 21q22.3
Pathway: mRNA processing, organism-specific biosystem;
Function: androgen receptor binding; estrogen receptor binding; estrogen receptor binding; histone methyltransferase activity; histone-arginine N-methyltransferase activity; methyltransferase activity; peroxisome proliferator activated receptor binding; progesterone receptor binding

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.