Recombinant Human PRMT2 Protein, transcript variant 1, C-Flag-tagged

Cat.No. : PRMT2-02H
Product Overview : Recombinant Human PRMT2 Protein, transcript variant 1, fused to Flag-tag at C-terminus, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Flag
Description : Enables several functions, including nuclear receptor binding activity; peroxisome proliferator activated receptor binding activity; and protein homodimerization activity. Involved in several processes, including histone methylation; regulation of androgen receptor signaling pathway; and regulation of transcription, DNA-templated. Located in cytosol and nucleoplasm.
Form : 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol.
Molecular Mass : 48.9 kDa
AA Sequence : MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWIRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Notes : For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage : Store at -80 centigrade.
Concentration : >0.05 μg/μL as determined by microplate BCA method.
Use/Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Gene Name PRMT2 protein arginine methyltransferase 2 [ Homo sapiens (human) ]
Official Symbol PRMT2
Synonyms HRMT1L1; protein arginine methyltransferase 2; NECTIN3
Gene ID 3275
mRNA Refseq NM_206962.4
Protein Refseq NP_996845.1
MIM 601961
UniProt ID P55345

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRMT2 Products

Required fields are marked with *

My Review for All PRMT2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon