Recombinant Human PRMT5 protein, GST-tagged

Cat.No. : PRMT5-1969H
Product Overview : Recombinant Human PRMT5 protein(283-637 aa), fused with N-terminal GST tag, was expressed in E. coli.
Availability April 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 283-637 aa
Tag : N-GST
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : YLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Gene Name PRMT5 protein arginine methyltransferase 5 [ Homo sapiens ]
Official Symbol PRMT5
Synonyms PRMT5; protein arginine methyltransferase 5; HRMT1L5, SKB1, skb1 (S. pombe) homolog , SKB1 homolog (S. pombe); protein arginine N-methyltransferase 5; SKB1Hs; SKB1 homolog; jak-binding protein 1; 72 kDa ICln-binding protein; HMT1 hnRNP methyltransferase-like 5; shk1 kinase-binding protein 1 homolog; histone-arginine N-methyltransferase PRMT5; JBP1; SKB1; IBP72; HRMT1L5;
Gene ID 10419
mRNA Refseq NM_001039619
Protein Refseq NP_001034708
MIM 604045
UniProt ID O14744

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PRMT5 Products

Required fields are marked with *

My Review for All PRMT5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon