Recombinant Human PRND Protein, His-tagged

Cat.No. : PRND-01H
Product Overview : Recombinant human PRND protein (27-152aa), fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.
Availability November 09, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 27-152 a.a.
Description : This gene is found on chromosome 20, approximately 20 kbp downstream of the gene encoding cellular prion protein, to which it is biochemically and structurally similar. The protein encoded by this gene is a membrane glycosylphosphatidylinositol-anchored glycoprotein that is found predominantly in testis. Mutations in this gene may lead to neurological disorders.
Form : Liquid
Molecular Mass : 16.9 kDa (149aa) confirmed by MALDI-TOF
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSRGIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDFGAEGNRYYEANYWQFPDGIHYNGCSEANVTKEAFVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKHCEFWLERG
Purity : > 95% by SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by Bradford assay)
Storage Buffer : 20mM Tris-HCl buffer (pH 7.5) containing 0.2M NaCl, 30% glycerol, 1mM DTT
Gene Name PRND prion like protein doppel [ Homo sapiens (human) ]
Official Symbol PRND
Synonyms PRND; prion like protein doppel; DPL; PrPLP; DOPPEL; dJ1068H6.4; prion-like protein doppel; downstream prion protein-like; prion gene complex, downstream; prion protein 2 (dublet)
Gene ID 23627
mRNA Refseq NM_012409
Protein Refseq NP_036541
MIM 604263
UniProt ID Q9UKY0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRND Products

Required fields are marked with *

My Review for All PRND Products

Required fields are marked with *

0
cart-icon
0
compare icon