Recombinant Human PRND Protein, His-tagged
Cat.No. : | PRND-01H |
Product Overview : | Recombinant human PRND protein (27-152aa), fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 27-152 a.a. |
Description : | This gene is found on chromosome 20, approximately 20 kbp downstream of the gene encoding cellular prion protein, to which it is biochemically and structurally similar. The protein encoded by this gene is a membrane glycosylphosphatidylinositol-anchored glycoprotein that is found predominantly in testis. Mutations in this gene may lead to neurological disorders. |
Form : | Liquid |
Molecular Mass : | 16.9 kDa (149aa) confirmed by MALDI-TOF |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSRGIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDFGAEGNRYYEANYWQFPDGIHYNGCSEANVTKEAFVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKHCEFWLERG |
Purity : | > 95% by SDS-PAGE |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.25 mg/mL (determined by Bradford assay) |
Storage Buffer : | 20mM Tris-HCl buffer (pH 7.5) containing 0.2M NaCl, 30% glycerol, 1mM DTT |
Gene Name | PRND prion like protein doppel [ Homo sapiens (human) ] |
Official Symbol | PRND |
Synonyms | PRND; prion like protein doppel; DPL; PrPLP; DOPPEL; dJ1068H6.4; prion-like protein doppel; downstream prion protein-like; prion gene complex, downstream; prion protein 2 (dublet) |
Gene ID | 23627 |
mRNA Refseq | NM_012409 |
Protein Refseq | NP_036541 |
MIM | 604263 |
UniProt ID | Q9UKY0 |
◆ Recombinant Proteins | ||
PRND-2805M | Recombinant Mouse PRND Protein (27-155 aa), His-Myc-tagged | +Inquiry |
PRND-650H | Recombinant Human PRND Protein, His-tagged | +Inquiry |
PRND-3616R | Recombinant Rhesus monkey PRND Protein, His-tagged | +Inquiry |
PRND-2936H | Recombinant Human PRND protein, His-tagged | +Inquiry |
PRND-2709H | Recombinant Human PRND protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRND Products
Required fields are marked with *
My Review for All PRND Products
Required fields are marked with *
0
Inquiry Basket