Recombinant Human PRND protein, His-tagged
Cat.No. : | PRND-2936H |
Product Overview : | Recombinant Human PRND protein(28-176 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 28-176 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | GIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDFGAEGNRYYEANYWQFPDGIHYNGCSEANVTKEAFVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKHCEFWLERGAGLRVTMHQPVLLCLLALIWLMVK |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PRND prion protein 2 (dublet) [ Homo sapiens ] |
Official Symbol | PRND |
Synonyms | PRND; prion protein 2 (dublet); prion-like protein doppel; dJ1068H6.4; DOPPEL; DPL; prion like protein doppel; PrPLP; prion gene complex, downstream; MGC41841; |
Gene ID | 23627 |
mRNA Refseq | NM_012409 |
Protein Refseq | NP_036541 |
MIM | 604263 |
UniProt ID | Q9UKY0 |
◆ Recombinant Proteins | ||
PRND-01H | Recombinant Human PRND Protein, His-tagged | +Inquiry |
PRND-7224H | Recombinant Human PRND, His-tagged | +Inquiry |
PRND-649H | Recombinant Human PRND Protein, Fc-tagged | +Inquiry |
PRND-3616R | Recombinant Rhesus monkey PRND Protein, His-tagged | +Inquiry |
PRND-2805M | Recombinant Mouse PRND Protein (27-155 aa), His-Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRND Products
Required fields are marked with *
My Review for All PRND Products
Required fields are marked with *
0
Inquiry Basket