Recombinant Human PRNP Protein
| Cat.No. : | PRNP-388H |
| Product Overview : | Recombinant Human PRNP(23-230 aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 23-230 aa |
| Description : | Prion Protein (PrP) is an abundant cellular protein in mammalian neural tissue. It is associated with mammalian prion diseases, e.g. transmissible spongiforme encephalophathies that include human Creutzfeld-Jakob disease, bovine spongiforme encephalopathy, sheep scrapie, cervid’s chronic wasting disease and various rodent prion diseases. In the disease process, PrP undergoes protein aggregation into disease specific PrPSc. |
| Form : | Finally dialysed in pure water, shock frozen in liquid nitrogen at 250 µg per vial |
| Molecular Mass : | 22891 g/mol |
| AA Sequence : | GSKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPI IHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGS |
| Purity : | > 95% by SDS-PAGE |
| Applications : | Prion Protein is frequently used in analytical aggregation assays |
| Notes : | Thawing: Gentle agitation at 37 centigrade until no ice is left. Keep on ice. Do not refreeze |
| Storage : | Store at -80 centigrade |
| Gene Name | PRNP prion protein [ Homo sapiens ] |
| Official Symbol | PRNP |
| Synonyms | PRNP; prion protein; CJD, GSS, prion protein (p27 30) , PRIP; major prion protein; CD230; Creutzfeldt Jakob disease; fatal familial insomnia; Gerstmann Strausler Scheinker syndrome; p27 30; PRP; CD230 antigen; prion-related protein; CJD; GSS; PrP; ASCR; PRIP; PrPc; p27-30; PrP27-30; PrP33-35C; MGC26679; |
| Gene ID | 5621 |
| mRNA Refseq | NM_000311 |
| Protein Refseq | NP_000302 |
| MIM | 176640 |
| UniProt ID | P04156 |
| ◆ Recombinant Proteins | ||
| PRNP-7569H | Recombinant Human PRNP, His-tagged | +Inquiry |
| Prnp-654H | Recombinant Hamster Prnp Protein, His-tagged | +Inquiry |
| Prnp-5501R | Recombinant Rat Prnp protein, His-tagged | +Inquiry |
| PRNP-7129M | Recombinant Mouse PRNP Protein, His (Fc)-Avi-tagged | +Inquiry |
| PRNP-812C | Recombinant Cynomolgus PRNP Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRNP-001HCL | Recombinant Human PRNP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRNP Products
Required fields are marked with *
My Review for All PRNP Products
Required fields are marked with *
