Recombinant Human PRNP Protein

Cat.No. : PRNP-388H
Product Overview : Recombinant Human PRNP(23-230 aa) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 23-230 aa
Description : Prion Protein (PrP) is an abundant cellular protein in mammalian neural tissue. It is associated with mammalian prion diseases, e.g. transmissible spongiforme encephalophathies that include human Creutzfeld-Jakob disease, bovine spongiforme encephalopathy, sheep scrapie, cervid’s chronic wasting disease and various rodent prion diseases. In the disease process, PrP undergoes protein aggregation into disease specific PrPSc.
Form : Finally dialysed in pure water, shock frozen in liquid nitrogen at 250 µg per vial
Molecular Mass : 22891 g/mol
AA Sequence : GSKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPI
IHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGS
Purity : > 95% by SDS-PAGE
Applications : Prion Protein is frequently used in analytical aggregation assays
Notes : Thawing: Gentle agitation at 37 centigrade until no ice is left. Keep on ice. Do not refreeze
Storage : Store at -80 centigrade
Gene Name PRNP prion protein [ Homo sapiens ]
Official Symbol PRNP
Synonyms PRNP; prion protein; CJD, GSS, prion protein (p27 30) , PRIP; major prion protein; CD230; Creutzfeldt Jakob disease; fatal familial insomnia; Gerstmann Strausler Scheinker syndrome; p27 30; PRP; CD230 antigen; prion-related protein; CJD; GSS; PrP; ASCR; PRIP; PrPc; p27-30; PrP27-30; PrP33-35C; MGC26679;
Gene ID 5621
mRNA Refseq NM_000311
Protein Refseq NP_000302
MIM 176640
UniProt ID P04156

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRNP Products

Required fields are marked with *

My Review for All PRNP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon