Recombinant Human PRNP Protein
Cat.No. : | PRNP-388H |
Product Overview : | Recombinant Human PRNP(23-230 aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 23-230 aa |
Description : | Prion Protein (PrP) is an abundant cellular protein in mammalian neural tissue. It is associated with mammalian prion diseases, e.g. transmissible spongiforme encephalophathies that include human Creutzfeld-Jakob disease, bovine spongiforme encephalopathy, sheep scrapie, cervid’s chronic wasting disease and various rodent prion diseases. In the disease process, PrP undergoes protein aggregation into disease specific PrPSc. |
Form : | Finally dialysed in pure water, shock frozen in liquid nitrogen at 250 µg per vial |
Molecular Mass : | 22891 g/mol |
AA Sequence : | GSKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPI IHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGS |
Purity : | > 95% by SDS-PAGE |
Applications : | Prion Protein is frequently used in analytical aggregation assays |
Notes : | Thawing: Gentle agitation at 37 centigrade until no ice is left. Keep on ice. Do not refreeze |
Storage : | Store at -80 centigrade |
Gene Name | PRNP prion protein [ Homo sapiens ] |
Official Symbol | PRNP |
Synonyms | PRNP; prion protein; CJD, GSS, prion protein (p27 30) , PRIP; major prion protein; CD230; Creutzfeldt Jakob disease; fatal familial insomnia; Gerstmann Strausler Scheinker syndrome; p27 30; PRP; CD230 antigen; prion-related protein; CJD; GSS; PrP; ASCR; PRIP; PrPc; p27-30; PrP27-30; PrP33-35C; MGC26679; |
Gene ID | 5621 |
mRNA Refseq | NM_000311 |
Protein Refseq | NP_000302 |
MIM | 176640 |
UniProt ID | P04156 |
◆ Recombinant Proteins | ||
PRNP-3617R | Recombinant Rhesus monkey PRNP Protein, His-tagged | +Inquiry |
PRNP-7569H | Recombinant Human PRNP, His-tagged | +Inquiry |
Prnp-653H | Recombinant Hamster Prnp Protein, His-tagged | +Inquiry |
PRNP-13424M | Recombinant Mouse PRNP Protein | +Inquiry |
PRNP-7014C | Recombinant Chicken PRNP | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRNP-001HCL | Recombinant Human PRNP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRNP Products
Required fields are marked with *
My Review for All PRNP Products
Required fields are marked with *
0
Inquiry Basket