Recombinant Human PROK1 Protein

Cat.No. : PROK1-230H
Product Overview : Recombinant Human PROK1 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Endocrine gland-derived vascular endothelial growth factor (EG-VEGF) is an angiogenic growth factor that is expressed in the ovaries, testis, adrenal, and placental tissues. EG-VEGF has mitogenic, chemoattractive, and antiapoptotic functional roles. EG-VEGF signaling is mediated through binding the G protein-coupled receptors prokineticin receptor 1 (PKR1) and prokineticin receptor 2 (PKR2). Polycystic ovaries display strong EG-VEGF expression that is associated with increased angiogenesis and cyst formation, which could lead to the formation of polycystic ovary syndrome and infertility.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 9.7 kDa (86 aa)
AA Sequence : AVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade, and avoid repeat freeze thaws.
Gene Name PROK1 prokineticin 1 [ Homo sapiens (human) ]
Official Symbol PROK1
Synonyms PROK1; prokineticin 1; prokineticin-1; black mamba toxin related protein; EGVEGF; mambakine; PK1; PRK1; EG-VEGF; black mamba toxin-related protein; endocrine-gland-derived vascular endothelial growth factor;
Gene ID 84432
mRNA Refseq NM_032414
Protein Refseq NP_115790
MIM 606233
UniProt ID P58294

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PROK1 Products

Required fields are marked with *

My Review for All PROK1 Products

Required fields are marked with *

0
cart-icon
0
compare icon