Recombinant Human PROM1 Protein, C-His-tagged

• Cat.No.: PROM1-161H
• Product Overview: Recombinant Human PROM1 Protein with C-His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: CD133, also known as Prominin, was first described as a cell surface marker recognized by monoclonal antibody AC133 on putative hematopoietic stem cells. Subsequent cDNA cloning indicated that CD133 is a five-transmembrane protein with a predicated molecular weight of 97 kDa. Due to heavy glycosylation, its apparent molecular weight is 130 kDa as determined by SDS-PAGE analysis. Besides blood stem cells, CD133 is expressed on and used to isolate other stem cells, including cancer stem cells. A deletion mutation in CD133 produces aberrant protein localization and may result in retinal degeneration in humans.
• Molecular Mass: ~31 kDa
• AA Sequence: GANVEKLICEPYTSKELFRVLDTPYLLNEDWEYYLSGKLFNKSKMKLTFEQVYSDCKKNRGTYGTLHLQNSFNISEHLNINEHTGSISSELESLKVNLNIFLLGAAGRKNLQDFAACGIDRMNYDSYLAQTGKSPAGVNLLSFAYDLEAKANSLPPGNLRNSLKRDAQTIKTIHQQRVLPIEQSLSTLYQSVKILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDPLN
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Concentration: ≥0.5 mg/mL
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: PROM1 prominin 1 [ Homo sapiens (human) ]
• Official Symbol: PROM1
• Synonyms: PROM1; prominin 1; macular dystrophy, retinal 2 , MCDR2, prominin (mouse) like 1 , PROML1, Stargardt disease 4 (autosomal dominant) , STGD4; prominin-1; AC133; CD133; RP41; hProminin; antigen AC133; prominin-like protein 1; hematopoietic stem cell antigen; MCDR2; STGD4; CORD12; PROML1; MSTP061
• Gene ID: 8842
• mRNA Refseq: NM_001145847
• Protein Refseq: NP_001139319
• MIM: 604365
• UniProt ID: O43490