Recombinant Human PROM1 Protein, C-His-tagged

Cat.No. : PROM1-161H
Product Overview : Recombinant Human PROM1 Protein with C-His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : CD133, also known as Prominin, was first described as a cell surface marker recognized by monoclonal antibody AC133 on putative hematopoietic stem cells. Subsequent cDNA cloning indicated that CD133 is a five-transmembrane protein with a predicated molecular weight of 97 kDa. Due to heavy glycosylation, its apparent molecular weight is 130 kDa as determined by SDS-PAGE analysis. Besides blood stem cells, CD133 is expressed on and used to isolate other stem cells, including cancer stem cells. A deletion mutation in CD133 produces aberrant protein localization and may result in retinal degeneration in humans.
Molecular Mass : ~31 kDa
AA Sequence : GANVEKLICEPYTSKELFRVLDTPYLLNEDWEYYLSGKLFNKSKMKLTFEQVYSDCKKNRGTYGTLHLQNSFNISEHLNINEHTGSISSELESLKVNLNIFLLGAAGRKNLQDFAACGIDRMNYDSYLAQTGKSPAGVNLLSFAYDLEAKANSLPPGNLRNSLKRDAQTIKTIHQQRVLPIEQSLSTLYQSVKILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDPLN
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Concentration : ≥0.5 mg/mL
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name PROM1 prominin 1 [ Homo sapiens (human) ]
Official Symbol PROM1
Synonyms PROM1; prominin 1; macular dystrophy, retinal 2 , MCDR2, prominin (mouse) like 1 , PROML1, Stargardt disease 4 (autosomal dominant) , STGD4; prominin-1; AC133; CD133; RP41; hProminin; antigen AC133; prominin-like protein 1; hematopoietic stem cell antigen; MCDR2; STGD4; CORD12; PROML1; MSTP061;
Gene ID 8842
mRNA Refseq NM_001145847
Protein Refseq NP_001139319
MIM 604365
UniProt ID O43490

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PROM1 Products

Required fields are marked with *

My Review for All PROM1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon