Recombinant Human PROM1 Protein, C-His-tagged
Cat.No. : | PROM1-161H |
Product Overview : | Recombinant Human PROM1 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | CD133, also known as Prominin, was first described as a cell surface marker recognized by monoclonal antibody AC133 on putative hematopoietic stem cells. Subsequent cDNA cloning indicated that CD133 is a five-transmembrane protein with a predicated molecular weight of 97 kDa. Due to heavy glycosylation, its apparent molecular weight is 130 kDa as determined by SDS-PAGE analysis. Besides blood stem cells, CD133 is expressed on and used to isolate other stem cells, including cancer stem cells. A deletion mutation in CD133 produces aberrant protein localization and may result in retinal degeneration in humans. |
Molecular Mass : | ~31 kDa |
AA Sequence : | GANVEKLICEPYTSKELFRVLDTPYLLNEDWEYYLSGKLFNKSKMKLTFEQVYSDCKKNRGTYGTLHLQNSFNISEHLNINEHTGSISSELESLKVNLNIFLLGAAGRKNLQDFAACGIDRMNYDSYLAQTGKSPAGVNLLSFAYDLEAKANSLPPGNLRNSLKRDAQTIKTIHQQRVLPIEQSLSTLYQSVKILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDPLN |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | PROM1 prominin 1 [ Homo sapiens (human) ] |
Official Symbol | PROM1 |
Synonyms | PROM1; prominin 1; macular dystrophy, retinal 2 , MCDR2, prominin (mouse) like 1 , PROML1, Stargardt disease 4 (autosomal dominant) , STGD4; prominin-1; AC133; CD133; RP41; hProminin; antigen AC133; prominin-like protein 1; hematopoietic stem cell antigen; MCDR2; STGD4; CORD12; PROML1; MSTP061; |
Gene ID | 8842 |
mRNA Refseq | NM_001145847 |
Protein Refseq | NP_001139319 |
MIM | 604365 |
UniProt ID | O43490 |
◆ Recombinant Proteins | ||
Prom1-120RAF488 | Recombinant Rat Prom1 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
PROM1-5259H | Recombinant Human PROM1 Protein (Ser279-Gly390), C-His tagged | +Inquiry |
Prom1-121R | Recombinant Rat Prom1, His-tagged | +Inquiry |
PROM1-46H | Recombinant Full Length Human PROM1 Protein, Isoform 2, Flag tagged | +Inquiry |
CD133-90H | Recombinant Human Prominin 1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PROM1-981RCL | Recombinant Rat PROM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PROM1 Products
Required fields are marked with *
My Review for All PROM1 Products
Required fields are marked with *
0
Inquiry Basket