Recombinant Human prostate stem cell antigen Protein, Fc tagged, Biotinylated

Cat.No. : PSCA-03H
Product Overview : The recombinant human PSCA-Fc is expressed as a 312-amino acid protein consisting of Leu21-Ser95 region (Extracellular Domain) of PSCA (UniProt accession #O43653) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Fc
Protein Length : 21-95aa
Description : This gene encodes a glycosylphosphatidylinositol-anchored cell membrane glycoprotein. In addition to being highly expressed in the prostate it is also expressed in the bladder, placenta, colon, kidney, and stomach. This gene is up-regulated in a large proportion of prostate cancers and is also detected in cancers of the bladder and pancreas. This gene includes a polymorphism that results in an upstream start codon in some individuals; this polymorphism is thought to be associated with a risk for certain gastric and bladder cancers. Alternative splicing results in multiple transcript variants.
Tag : C-Fc
Conjugation/Label : Biotin
Molecular Mass : 34.8 kDa
AA Sequence : LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASTTENLYFQGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : < 0.1 EU/μg by LAL
Purity : > 95% by SDS-PAGE
Calculated PI : 6.02
Calculated Extinction Coefficient (M-1 cm-1, at 280nm) : 47870
Storage Buffer : Sterile PBS pH7.4 (carrier and preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Concentration : 0.5 mg/mL
Gene Name PSCA prostate stem cell antigen [ Homo sapiens (human) ]
Official Symbol PSCA
Synonyms PSCA; prostate stem cell antigen; PRO232; lncPSCA
Gene ID 8000
mRNA Refseq NM_005672
Protein Refseq NP_005663
MIM 602470
UniProt ID O43653

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PSCA Products

Required fields are marked with *

My Review for All PSCA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon