Recombinant Human PSCA Protein (21-95 aa), His-tagged
| Cat.No. : | PSCA-2097H |
| Product Overview : | Recombinant Human PSCA Protein (21-95 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Tags & Cell Markers. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 21-95 aa |
| Description : | May be involved in the regulation of cell proliferation. Has a cell-proliferation inhibition activity in vitro.1 Publication |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 10.2 kDa |
| AA Sequence : | LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | PSCA prostate stem cell antigen [ Homo sapiens ] |
| Official Symbol | PSCA |
| Synonyms | PSCA; prostate stem cell antigen; PRO232; |
| Gene ID | 8000 |
| mRNA Refseq | NM_005672 |
| Protein Refseq | NP_005663 |
| MIM | 602470 |
| UniProt ID | O43653 |
| ◆ Recombinant Proteins | ||
| PSCA-03H | Recombinant Human prostate stem cell antigen Protein, Fc tagged, Biotinylated | +Inquiry |
| PSCA-151H | Recombinant Human PSCA Protein, His-tagged | +Inquiry |
| PSCA-2002H | Recombinant Human PSCA protein, His-tagged | +Inquiry |
| PSCA-5744H | Recombinant Human PSCA protein, hFc-tagged | +Inquiry |
| PSCA-01HP | Recombinant Human PSCA Protein, C-His-tagged, PE-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PSCA-2791HCL | Recombinant Human PSCA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSCA Products
Required fields are marked with *
My Review for All PSCA Products
Required fields are marked with *
