Recombinant Human PRPS2, His-tagged
| Cat.No. : | PRPS2-181H |
| Product Overview : | Recombinant Human Ribose-Phosphate Pyrophosphokinase 2/PRPS2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Pro2-Leu318) of Human PRPS2 fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Description : | Ribose-Phosphate Pyrophosphokinase 2 (PRPS2) is a phosphoribosyl pyrophosphate synthetase that belongs to the ribose-phosphate pyrophosphokinase family. PRPS2 is a homodimer. The active form is probably an hexamer composed of three homodimers. PRPS2 catalyzes the synthesis of phosphoribosylpyrophosphate (PRPP) that is essential for nucleotide synthesis. PRPS2 catalyzes the synthesis of 5-phosphoribosyl 1-pyrophosphate from ATP and D-ribose 5-phosphate. In addition, PRPS2 plays a central role in the synthesis of purines and pyrimidines. |
| AA Sequence : | MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEIND NLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLH ASQIQGFFDIPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKE RKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISR INNAAFEAVVVTNTIPQEDKMKHCTKIQVIDISMILAEAIRRTHNGESVSYLFSHVPLVDHHHHH H |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
| Gene Name | PRPS2 phosphoribosyl pyrophosphate synthetase 2 [ Homo sapiens ] |
| Official Symbol | PRPS2 |
| Synonyms | PRPS2; phosphoribosyl pyrophosphate synthetase 2; ribose-phosphate pyrophosphokinase 2; PRS II; ribose phosphate diphosphokinase 2; PRS-II; PPRibP synthetase; ribose-phosphate diphosphokinase 2; phosphoribosyl pyrophosphate synthase II; PRSII; |
| Gene ID | 5634 |
| mRNA Refseq | NM_001039091 |
| Protein Refseq | NP_001034180 |
| MIM | 311860 |
| UniProt ID | P11908 |
| Chromosome Location | Xpter-q21 |
| Pathway | 5-Phosphoribose 1-diphosphate biosynthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of carbohydrates, organism-specific biosystem; Nucleotide Metabolism, organism-specific biosystem; PRPP biosynthesis I, organism-specific biosystem; PRPP biosynthesis, ribose 5P => |
| Function | ATP binding; kinase activity; magnesium ion binding; nucleotide binding; protein homodimerization activity; ribose phosphate diphosphokinase activity; transferase activity; |
| ◆ Recombinant Proteins | ||
| PRPS2-90H | Recombinant Human PRPS2, His-tagged | +Inquiry |
| PRPS2-4724R | Recombinant Rat PRPS2 Protein | +Inquiry |
| PRPS2-1411C | Recombinant Chicken PRPS2 | +Inquiry |
| PRPS2-189H | Recombinant Human PRPS2 protein, T7/His-tagged | +Inquiry |
| Prps2-479M | Recombinant Mouse Prps2 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRPS2-505HCL | Recombinant Human PRPS2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRPS2 Products
Required fields are marked with *
My Review for All PRPS2 Products
Required fields are marked with *



