Recombinant Human PRPS2, His-tagged

• Cat.No.: PRPS2-181H
• Product Overview: Recombinant Human Ribose-Phosphate Pyrophosphokinase 2/PRPS2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Pro2-Leu318) of Human PRPS2 fused with a 6His tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Description: Ribose-Phosphate Pyrophosphokinase 2 (PRPS2) is a phosphoribosyl pyrophosphate synthetase that belongs to the ribose-phosphate pyrophosphokinase family. PRPS2 is a homodimer. The active form is probably an hexamer composed of three homodimers. PRPS2 catalyzes the synthesis of phosphoribosylpyrophosphate (PRPP) that is essential for nucleotide synthesis. PRPS2 catalyzes the synthesis of 5-phosphoribosyl 1-pyrophosphate from ATP and D-ribose 5-phosphate. In addition, PRPS2 plays a central role in the synthesis of purines and pyrimidines.
• AA Sequence: MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEIND NLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLH ASQIQGFFDIPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKE RKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISR INNAAFEAVVVTNTIPQEDKMKHCTKIQVIDISMILAEAIRRTHNGESVSYLFSHVPLVDHHHHH H
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by reducing SDS-PAGE.

Gene Information

• Gene Name: PRPS2 phosphoribosyl pyrophosphate synthetase 2 [ Homo sapiens ]
• Official Symbol: PRPS2
• Synonyms: PRPS2; phosphoribosyl pyrophosphate synthetase 2; ribose-phosphate pyrophosphokinase 2; PRS II; ribose phosphate diphosphokinase 2; PRS-II; PPRibP synthetase; ribose-phosphate diphosphokinase 2; phosphoribosyl pyrophosphate synthase II; PRSII
• Gene ID: 5634
• mRNA Refseq: NM_001039091
• Protein Refseq: NP_001034180
• MIM: 311860
• UniProt ID: P11908
• Chromosome Location: Xpter-q21
• Pathway: 5-Phosphoribose 1-diphosphate biosynthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of carbohydrates, organism-specific biosystem; Nucleotide Metabolism, organism-specific biosystem; PRPP biosynthesis I, organism-specific biosystem; PRPP biosynthesis, ribose 5P =>
• Function: ATP binding; kinase activity; magnesium ion binding; nucleotide binding; protein homodimerization activity; ribose phosphate diphosphokinase activity; transferase activity