Recombinant Human PRPS2, His-tagged
Cat.No. : | PRPS2-181H |
Product Overview : | Recombinant Human Ribose-Phosphate Pyrophosphokinase 2/PRPS2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Pro2-Leu318) of Human PRPS2 fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | Ribose-Phosphate Pyrophosphokinase 2 (PRPS2) is a phosphoribosyl pyrophosphate synthetase that belongs to the ribose-phosphate pyrophosphokinase family. PRPS2 is a homodimer. The active form is probably an hexamer composed of three homodimers. PRPS2 catalyzes the synthesis of phosphoribosylpyrophosphate (PRPP) that is essential for nucleotide synthesis. PRPS2 catalyzes the synthesis of 5-phosphoribosyl 1-pyrophosphate from ATP and D-ribose 5-phosphate. In addition, PRPS2 plays a central role in the synthesis of purines and pyrimidines. |
AA Sequence : | MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEIND NLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLH ASQIQGFFDIPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKE RKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISR INNAAFEAVVVTNTIPQEDKMKHCTKIQVIDISMILAEAIRRTHNGESVSYLFSHVPLVDHHHHH H |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Gene Name | PRPS2 phosphoribosyl pyrophosphate synthetase 2 [ Homo sapiens ] |
Official Symbol | PRPS2 |
Synonyms | PRPS2; phosphoribosyl pyrophosphate synthetase 2; ribose-phosphate pyrophosphokinase 2; PRS II; ribose phosphate diphosphokinase 2; PRS-II; PPRibP synthetase; ribose-phosphate diphosphokinase 2; phosphoribosyl pyrophosphate synthase II; PRSII; |
Gene ID | 5634 |
mRNA Refseq | NM_001039091 |
Protein Refseq | NP_001034180 |
MIM | 311860 |
UniProt ID | P11908 |
Chromosome Location | Xpter-q21 |
Pathway | 5-Phosphoribose 1-diphosphate biosynthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of carbohydrates, organism-specific biosystem; Nucleotide Metabolism, organism-specific biosystem; PRPP biosynthesis I, organism-specific biosystem; PRPP biosynthesis, ribose 5P => |
Function | ATP binding; kinase activity; magnesium ion binding; nucleotide binding; protein homodimerization activity; ribose phosphate diphosphokinase activity; transferase activity; |
◆ Recombinant Proteins | ||
PRPS2-3750H | Recombinant Human PRPS2 protein, GST-tagged | +Inquiry |
PRPS2-6013H | Recombinant Human PRPS2 Protein (Pro2-Leu318), C-His tagged | +Inquiry |
PRPS2-90H | Recombinant Human PRPS2, His-tagged | +Inquiry |
PRPS2-4383R | Recombinant Rat PRPS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRPS2-181H | Recombinant Human PRPS2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRPS2-505HCL | Recombinant Human PRPS2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRPS2 Products
Required fields are marked with *
My Review for All PRPS2 Products
Required fields are marked with *
0
Inquiry Basket