Recombinant Human PRPS2 protein, GST-tagged
Cat.No. : | PRPS2-3750H |
Product Overview : | Recombinant Human PRPS2 protein(143-273 aa), fused to GST tag, was expressed in E. coli. |
Availability | July 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 143-273 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | IPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVV |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PRPS2 phosphoribosyl pyrophosphate synthetase 2 [ Homo sapiens ] |
Official Symbol | PRPS2 |
Synonyms | PRPS2; phosphoribosyl pyrophosphate synthetase 2; ribose-phosphate pyrophosphokinase 2; PRS II; ribose phosphate diphosphokinase 2; PRS-II; PPRibP synthetase; ribose-phosphate diphosphokinase 2; phosphoribosyl pyrophosphate synthase II; PRSII; |
Gene ID | 5634 |
mRNA Refseq | NM_001039091 |
Protein Refseq | NP_001034180 |
MIM | 311860 |
UniProt ID | P11908 |
◆ Recombinant Proteins | ||
PRPS2-3030H | Recombinant Human PRPS2 Protein, MYC/DDK-tagged | +Inquiry |
PRPS2-90H | Recombinant Human PRPS2, His-tagged | +Inquiry |
PRPS2-189H | Recombinant Human PRPS2 protein, T7/His-tagged | +Inquiry |
PRPS2-4383R | Recombinant Rat PRPS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRPS2-1411C | Recombinant Chicken PRPS2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRPS2-505HCL | Recombinant Human PRPS2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRPS2 Products
Required fields are marked with *
My Review for All PRPS2 Products
Required fields are marked with *