Recombinant Human PRPS2 protein, GST-tagged
Cat.No. : | PRPS2-3750H |
Product Overview : | Recombinant Human PRPS2 protein(143-273 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | September 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 143-273 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | IPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVV |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | PRPS2 phosphoribosyl pyrophosphate synthetase 2 [ Homo sapiens ] |
Official Symbol | PRPS2 |
Synonyms | PRPS2; phosphoribosyl pyrophosphate synthetase 2; ribose-phosphate pyrophosphokinase 2; PRS II; ribose phosphate diphosphokinase 2; PRS-II; PPRibP synthetase; ribose-phosphate diphosphokinase 2; phosphoribosyl pyrophosphate synthase II; PRSII; |
Gene ID | 5634 |
mRNA Refseq | NM_001039091 |
Protein Refseq | NP_001034180 |
MIM | 311860 |
UniProt ID | P11908 |
◆ Recombinant Proteins | ||
PRPS2-3750H | Recombinant Human PRPS2 protein, GST-tagged | +Inquiry |
PRPS2-374H | Recombinant Human PRPS2 protein, His-tagged | +Inquiry |
Prps2-479M | Recombinant Mouse Prps2 Protein, MYC/DDK-tagged | +Inquiry |
PRPS2-181H | Recombinant Human PRPS2, His-tagged | +Inquiry |
PRPS2-3030H | Recombinant Human PRPS2 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRPS2-505HCL | Recombinant Human PRPS2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRPS2 Products
Required fields are marked with *
My Review for All PRPS2 Products
Required fields are marked with *