Recombinant Human PRSS1 protein(104-206aa), His-GST-tagged

• Cat.No.: PRSS1-2173H
• Product Overview: Recombinant Human PRSS1 protein(P07477)(104-206aa), fused with N-terminal His and GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST&His
• Protein Length: 104-206aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 42.1 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: LNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVC

Gene Information

• Gene Name: PRSS1 protease, serine, 1 (trypsin 1) [ Homo sapiens ]
• Official Symbol: PRSS1
• Synonyms: PRSS1; protease, serine, 1 (trypsin 1); TRY1; trypsin-1; beta-trypsin; trypsinogen 1; trypsinogen A; digestive zymogen; cationic trypsinogen; nonfunctional trypsin 1; TRP1; TRY4; TRYP1; FLJ57296; MGC120175; MGC149362; DKFZp779A0837
• Gene ID: 5644
• mRNA Refseq: NM_002769
• Protein Refseq: NP_002760
• MIM: 276000
• UniProt ID: P07477