Recombinant Human PRSS1 protein(104-206aa), His-GST-tagged

Cat.No. : PRSS1-2173H
Product Overview : Recombinant Human PRSS1 protein(P07477)(104-206aa), fused with N-terminal His and GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST&His
Protein Length : 104-206aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 42.1 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : LNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVC
Gene Name PRSS1 protease, serine, 1 (trypsin 1) [ Homo sapiens ]
Official Symbol PRSS1
Synonyms PRSS1; protease, serine, 1 (trypsin 1); TRY1; trypsin-1; beta-trypsin; trypsinogen 1; trypsinogen A; digestive zymogen; cationic trypsinogen; nonfunctional trypsin 1; TRP1; TRY4; TRYP1; FLJ57296; MGC120175; MGC149362; DKFZp779A0837;
Gene ID 5644
mRNA Refseq NM_002769
Protein Refseq NP_002760
MIM 276000
UniProt ID P07477

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRSS1 Products

Required fields are marked with *

My Review for All PRSS1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon