Recombinant Rat Prss1 protein, His-tagged
| Cat.No. : | Prss1-3374R |
| Product Overview : | Recombinant Rat Prss1 protein(P00762)(24-246aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 24-246aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 27.2 kDa |
| AA Sequence : | IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Prss1 protease, serine, 1 (trypsin 1) [ Rattus norvegicus ] |
| Official Symbol | Prss1 |
| Synonyms | PRSS1; protease, serine, 1 (trypsin 1); anionic trypsin-1; pretrypsinogen I; anionic trypsin I; serine protease 1; protease, serine, 2; pancreatic trypsin 1; Try1; PTRYI; RATPTRYI; |
| Gene ID | 24691 |
| mRNA Refseq | NM_012635 |
| Protein Refseq | NP_036767 |
| ◆ Recombinant Proteins | ||
| PRSS1-3925H | Recombinant Human PRSS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PRSS1-3373H | Recombinant Human PRSS1 protein, His&Myc-tagged | +Inquiry |
| PRSS1-1494R | Recombinant Rat PRSS1 Protein (24–246 aa), His-tagged | +Inquiry |
| PRSS1-1047H | Active Recombinant Human PRSS1, His-tagged | +Inquiry |
| PRSS1-4737R | Recombinant Rat PRSS1 Protein | +Inquiry |
| ◆ Native Proteins | ||
| PRSS1-30745TH | Active Native Human PRSS1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRSS1-2806HCL | Recombinant Human PRSS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Prss1 Products
Required fields are marked with *
My Review for All Prss1 Products
Required fields are marked with *



