Recombinant Human PRTFDC1, His-tagged
Cat.No. : | PRTFDC1-30710TH |
Product Overview : | Recombinant full length Human PRTFDC1 with N terminal His tag; 248 amino acids with tag, Predicted MWt 28.1 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 225 amino acids |
Conjugation : | HIS |
Molecular Weight : | 28.100kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 40% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSMAGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVDRIERLAKDIMKDIGYSDIMVLCVLKGGYKFCADLVEHLKNISRNSDRFVSMKVDFIRLKSYRNDQSMGEMQIIGGDDLSTLAGKNVLIVEDVVGTGRTMKALLSNIEKYKPNMIKVASLLVKRTSRSDGFRPDYAGFEIPNLFVVGYALDYNEYFRDLNHICVINEHGKEKYRV |
Sequence Similarities : | Belongs to the purine/pyrimidine phosphoribosyltransferase family. |
Gene Name | PRTFDC1 phosphoribosyl transferase domain containing 1 [ Homo sapiens ] |
Official Symbol | PRTFDC1 |
Synonyms | PRTFDC1; phosphoribosyl transferase domain containing 1; phosphoribosyltransferase domain-containing protein 1; HHGP; |
Gene ID | 56952 |
mRNA Refseq | NM_020200 |
Protein Refseq | NP_064585 |
MIM | 610751 |
Uniprot ID | Q9NRG1 |
Chromosome Location | 10p12.31 |
Function | NOT hypoxanthine phosphoribosyltransferase activity; magnesium ion binding; magnesium ion binding; nucleotide binding; NOT phosphoglucomutase activity; |
◆ Recombinant Proteins | ||
PRTFDC1-8636H | Recombinant Human PRTFDC1, His tagged | +Inquiry |
PRTFDC1-999H | Recombinant Human PRTFDC1, His-tagged | +Inquiry |
PRTFDC1-30710TH | Recombinant Human PRTFDC1, His-tagged | +Inquiry |
PRTFDC1-4402C | Recombinant Chicken PRTFDC1 | +Inquiry |
PRTFDC1-9927Z | Recombinant Zebrafish PRTFDC1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRTFDC1-2799HCL | Recombinant Human PRTFDC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRTFDC1 Products
Required fields are marked with *
My Review for All PRTFDC1 Products
Required fields are marked with *