Recombinant Human PSCA Protein, C-His-tagged, PE-labeled
| Cat.No. : | PSCA-01HP |
| Product Overview : | Recombinant Human PSCA Protein, fused to His-tag at C-terminus, was expressed in HEK293T. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 21-95 aa |
| Description : | This gene encodes a glycosylphosphatidylinositol-anchored cell membrane glycoprotein. In addition to being highly expressed in the prostate it is also expressed in the bladder, placenta, colon, kidney, and stomach. This gene is up-regulated in a large proportion of prostate cancers and is also detected in cancers of the bladder and pancreas. This gene includes a polymorphism that results in an upstream start codon in some individuals; this polymorphism is thought to be associated with a risk for certain gastric and bladder cancers. Alternative splicing results in multiple transcript variants. |
| Molecular Mass : | ~ 8.8 kDa |
| AA Sequence : | VSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAHHHHHH |
| Purity : | >=85% as determined by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.83 mg/ml |
| Gene Name | PSCA prostate stem cell antigen [ Homo sapiens (human) ] |
| Official Symbol | PSCA |
| Synonyms | PRO232; lncPSCA; prostate stem cell antigen; PSCA |
| Gene ID | 8000 |
| mRNA Refseq | NM_005672.5 |
| Protein Refseq | NP_005663.2 |
| MIM | 602470 |
| UniProt ID | O43653 |
| ◆ Recombinant Proteins | ||
| PSCA-2001H | Recombinant Human PSCA, GST-tagged | +Inquiry |
| Psca-6742M | Recombinant Mouse Psca protein, His-tagged | +Inquiry |
| PSCA-0630H | Active Recombinant Human PSCA protein, His-Avi-tagged, Biotinylated | +Inquiry |
| PSCA-03H | Recombinant Human prostate stem cell antigen Protein, Fc tagged, Biotinylated | +Inquiry |
| PSCA-6600H | Recombinant Human PSCA Protein (Leu12-Ser86), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PSCA-2791HCL | Recombinant Human PSCA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSCA Products
Required fields are marked with *
My Review for All PSCA Products
Required fields are marked with *



