Recombinant Human PSCA Protein, C-His-tagged, PE-labeled

• Cat.No.: PSCA-01HP
• Product Overview: Recombinant Human PSCA Protein, fused to His-tag at C-terminus, was expressed in HEK293T.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 21-95 aa
• Description: This gene encodes a glycosylphosphatidylinositol-anchored cell membrane glycoprotein. In addition to being highly expressed in the prostate it is also expressed in the bladder, placenta, colon, kidney, and stomach. This gene is up-regulated in a large proportion of prostate cancers and is also detected in cancers of the bladder and pancreas. This gene includes a polymorphism that results in an upstream start codon in some individuals; this polymorphism is thought to be associated with a risk for certain gastric and bladder cancers. Alternative splicing results in multiple transcript variants.
• Molecular Mass: ~ 8.8 kDa
• AA Sequence: VSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAHHHHHH
• Purity: >=85% as determined by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.83 mg/ml

Gene Information

• Gene Name: PSCA prostate stem cell antigen [ Homo sapiens (human) ]
• Official Symbol: PSCA
• Synonyms: PRO232; lncPSCA; prostate stem cell antigen; PSCA
• Gene ID: 8000
• mRNA Refseq: NM_005672.5
• Protein Refseq: NP_005663.2
• MIM: 602470
• UniProt ID: O43653