Recombinant Human PSCA Protein, C-His-tagged, PE-labeled

Cat.No. : PSCA-01HP
Product Overview : Recombinant Human PSCA Protein, fused to His-tag at C-terminus, was expressed in HEK293T.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 21-95 aa
Description : This gene encodes a glycosylphosphatidylinositol-anchored cell membrane glycoprotein. In addition to being highly expressed in the prostate it is also expressed in the bladder, placenta, colon, kidney, and stomach. This gene is up-regulated in a large proportion of prostate cancers and is also detected in cancers of the bladder and pancreas. This gene includes a polymorphism that results in an upstream start codon in some individuals; this polymorphism is thought to be associated with a risk for certain gastric and bladder cancers. Alternative splicing results in multiple transcript variants.
Molecular Mass : ~ 8.8 kDa
AA Sequence : VSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAHHHHHH
Purity : >=85% as determined by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.83 mg/ml
Gene Name PSCA prostate stem cell antigen [ Homo sapiens (human) ]
Official Symbol PSCA
Synonyms PRO232; lncPSCA; prostate stem cell antigen; PSCA
Gene ID 8000
mRNA Refseq NM_005672.5
Protein Refseq NP_005663.2
MIM 602470
UniProt ID O43653

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PSCA Products

Required fields are marked with *

My Review for All PSCA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon