| Species : |
Human |
| Source : |
Wheat Germ |
| Tag : |
Non |
| Protein Length : |
392 amino acids |
| Description : |
The human placenta is a multihormonal endocrine organ that produces hormones, enzymes, and other molecules that support fetal survival and development. Pregnancy-specific beta-1-glycoprotein (PSBG, PSG) is a major product of the syncytiotrophoblast, reaching concentrations of 100 to 290 mg/l at term in the serum of pregnant women (Horne et al. |
| Molecular Weight : |
69.230kDa inclusive of tags |
| Form : |
Liquid |
| Purity : |
Proprietary Purification |
| Storage buffer : |
pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : |
Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : |
QVTIEAEPTKVSEGKDVLLLVHNLPQNLTGYIWYKGQMRD LYHYITSYVVDGEIIIYGPAYSGRETAYSNASLLIQNVTR EDAGSYTLHIIKGDDGTRGVTGRFTFTLHLETPKPSISSS NLNPRETMEAVSLTCDPETPDASYLWWMNGQSLPMTHSLK LSETNRTLFLLGVTKYTAGPYECEIRNPVSASRSDPVTLN LLPKLPKPYITINNLNPRENKDVLNFTCEPKSENYTYIWW LNGQSLPVSPRVRRPIENRILILPSVTRNETGPYQCEIRD RYGGIRSDPVTLNVLYGPDLPRIYPSFTYYRSGEVLYLSC SADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVC SVRNSATGKESSKSMTVEVSGKWIPASLAIGF |
| Sequence Similarities : |
Belongs to the immunoglobulin superfamily. CEA family.Contains 3 Ig-like C2-type (immunoglobulin-like) domains.Contains 1 Ig-like V-type (immunoglobulin-like) domain. |