Recombinant Human PSMB3, His-tagged
| Cat.No. : | PSMB3-31208TH |
| Product Overview : | Recombinant full length protein, corresponding to amino acids 1-205 of Human Proteasome beta 6, with an N-terminal His tag, 225aa, 25.1 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 246 amino acids |
| Description : | The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Pseudogenes have been identified on chromosomes 2 and 12. |
| Conjugation : | HIS |
| Molecular Weight : | 25.100kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 50% Glycerol, 1.17% Sodium chloride |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSIMSYNGGAVMAMKGKNCV AIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRF GPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSG TCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAV SGMGVIVHIIEKDKITTRTLKARMD |
| Sequence Similarities : | Belongs to the peptidase T1B family. |
| Gene Name | PSMB3 proteasome (prosome, macropain) subunit, beta type, 3 [ Homo sapiens ] |
| Official Symbol | PSMB3 |
| Synonyms | PSMB3; proteasome (prosome, macropain) subunit, beta type, 3; proteasome subunit beta type-3; HC10 II; MGC4147; |
| Gene ID | 5691 |
| mRNA Refseq | NM_002795 |
| Protein Refseq | NP_002786 |
| MIM | 602176 |
| Uniprot ID | P49720 |
| Chromosome Location | 17q12 |
| Pathway | APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; |
| Function | peptidase activity; threonine-type endopeptidase activity; |
| ◆ Recombinant Proteins | ||
| PSMB3-1540H | Recombinant Human Proteasome (Prosome, Macropain) Subunit, Beta Type, 3, His-tagged | +Inquiry |
| PSMB3-3381H | Recombinant Human PSMB3 protein, GST-tagged | +Inquiry |
| PSMB3-31208TH | Recombinant Human PSMB3, His-tagged | +Inquiry |
| PSMB3-2017H | Recombinant Human PSMB3, His-tagged | +Inquiry |
| PSMB3-3657R | Recombinant Rhesus monkey PSMB3 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PSMB3-2773HCL | Recombinant Human PSMB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSMB3 Products
Required fields are marked with *
My Review for All PSMB3 Products
Required fields are marked with *
