Recombinant Human PSMB3, His-tagged

Cat.No. : PSMB3-31208TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-205 of Human Proteasome beta 6, with an N-terminal His tag, 225aa, 25.1 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 246 amino acids
Description : The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Pseudogenes have been identified on chromosomes 2 and 12.
Conjugation : HIS
Molecular Weight : 25.100kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 50% Glycerol, 1.17% Sodium chloride
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMSIMSYNGGAVMAMKGKNCV AIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRF GPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSG TCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAV SGMGVIVHIIEKDKITTRTLKARMD
Sequence Similarities : Belongs to the peptidase T1B family.
Gene Name PSMB3 proteasome (prosome, macropain) subunit, beta type, 3 [ Homo sapiens ]
Official Symbol PSMB3
Synonyms PSMB3; proteasome (prosome, macropain) subunit, beta type, 3; proteasome subunit beta type-3; HC10 II; MGC4147;
Gene ID 5691
mRNA Refseq NM_002795
Protein Refseq NP_002786
MIM 602176
Uniprot ID P49720
Chromosome Location 17q12
Pathway APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem;
Function peptidase activity; threonine-type endopeptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PSMB3 Products

Required fields are marked with *

My Review for All PSMB3 Products

Required fields are marked with *

0
cart-icon