Recombinant Human PSRC1, GST-tagged
Cat.No. : | PSRC1-39H |
Product Overview : | Recombinant Human PSRC1(1 a.a. - 333 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
Availability | August 28, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a proline-rich protein that is a target for regulation by the tumor suppressor protein p53. The encoded protein plays an important role in mitosis by recruiting and regulating microtubule depolymerases that destabalize microtubules. Alternatively spliced transcript variants encoding different isoforms have been described. |
Molecular Mass : | 62 kDa |
AA Sequence : | MEDLEEDVRFIVDETLDFGGLSPSDSREEEDITVLVTPEKPLRRGLSHRSDPNAVAPAPQGVRLSLGPLSPEKLE EILDEANRLAAQLEQCALQDRESAGEGLGPRRVKPSPRRETFVLKDSPVRDLLPTVNSLTRSTPSPSSLTPRLRS NDRKGSVRALRATSGKRPSNMKRESPTCNLFPASKSPASSPLTRSTPPVRGRAGPSGRAAASPPTPIRSVLAPQP STSNSQRLPRPQGAAAKSSSQLPIPSAIPRPASRMPLTSRSVPPGRGALPPDSLSTRKGLPRPSTAGHRVRESGH KVPVSQRLNLPVMGATRSNLQPPRKVAVPGPTR |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PSRC1 proline/serine-rich coiled-coil 1 [ Homo sapiens ] |
Official Symbol | PSRC1 |
Synonyms | PSRC1; proline/serine-rich coiled-coil 1; proline/serine-rich coiled-coil protein 1; DDA3; differential display and activated by p53; DDA3; Differential display and activated by p53; FP3214; p53-regulated DDA3; Proline/serine-rich coiled-coil 1; proline/serine-rich coiled-coil protein 1; p53-regulated DDA3; FP3214 |
Gene ID | 84722 |
mRNA Refseq | NM_032636 |
Protein Refseq | NP_116025 |
MIM | 613126 |
UniProt ID | Q6PGN9 |
Chromosome Location | 1p13.3 |
Function | microtubule binding; protein binding |
◆ Recombinant Proteins | ||
PSRC1-4794R | Recombinant Rat PSRC1 Protein | +Inquiry |
PSRC1-3139H | Recombinant Human PSRC1 protein, His-tagged | +Inquiry |
PSRC1-4453R | Recombinant Rat PSRC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PSRC1-3500R | Recombinant Rhesus Macaque PSRC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PSRC1-3682R | Recombinant Rhesus monkey PSRC1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSRC1-447HCL | Recombinant Human PSRC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSRC1 Products
Required fields are marked with *
My Review for All PSRC1 Products
Required fields are marked with *