"PTGR1" Related Products

Expand
Expand

Recombinant Human PTGR1 Protein, GST-tagged

Cat.No. : PTGR1-4593H
Product Overview : Human LTB4DH partial ORF ( NP_036344, 230 a.a. - 328 a.a.) recombinant protein with GST-tag at N-terminal.
Description : This gene encodes an enzyme that is involved in the inactivation of the chemotactic factor, leukotriene B4. The encoded protein specifically catalyzes the NADP+ dependent conversion of leukotriene B4 to 12-oxo-leukotriene B4. A pseudogene of this gene is found on chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 36.63 kDa
AA Sequence : MKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing :

12.5% SDS-PAGE Stained with Coomassie Blue

Gene Name : PTGR1 prostaglandin reductase 1 [ Homo sapiens ]
Official Symbol : PTGR1
Synonyms : PTGR1; prostaglandin reductase 1; leukotriene B4 12 hydroxydehydrogenase , LTB4DH; ZADH3; zinc binding alcohol dehydrogenase domain containing 3; PRG-1; 15-oxoprostaglandin 13-reductase; leukotriene B4 12-hydroxydehydrogenase; NADP-dependent leukotriene B4 12-hydroxydehydrogenase; PGR1; LTB4DH; FLJ99229; MGC34943;
Gene ID : 22949
mRNA Refseq : NM_001146108
Protein Refseq : NP_001139580
MIM : 601274
UniProt ID : Q14914

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.