Recombinant Human PTGR1 Protein, GST-tagged
Cat.No. : | PTGR1-4593H |
Product Overview : | Human LTB4DH partial ORF ( NP_036344, 230 a.a. - 328 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an enzyme that is involved in the inactivation of the chemotactic factor, leukotriene B4. The encoded protein specifically catalyzes the NADP+ dependent conversion of leukotriene B4 to 12-oxo-leukotriene B4. A pseudogene of this gene is found on chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq |
Molecular Mass : | 36.63 kDa |
AA Sequence : | MKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PTGR1 prostaglandin reductase 1 [ Homo sapiens ] |
Official Symbol | PTGR1 |
Synonyms | PTGR1; prostaglandin reductase 1; leukotriene B4 12 hydroxydehydrogenase , LTB4DH; ZADH3; zinc binding alcohol dehydrogenase domain containing 3; PRG-1; 15-oxoprostaglandin 13-reductase; leukotriene B4 12-hydroxydehydrogenase; NADP-dependent leukotriene B4 12-hydroxydehydrogenase; PGR1; LTB4DH; FLJ99229; MGC34943; |
Gene ID | 22949 |
mRNA Refseq | NM_001146108 |
Protein Refseq | NP_001139580 |
MIM | 601274 |
UniProt ID | Q14914 |
◆ Recombinant Proteins | ||
PTGR1-3084C | Recombinant Chicken PTGR1 | +Inquiry |
PTGR1-4814R | Recombinant Rat PTGR1 Protein | +Inquiry |
PTGR1-4593H | Recombinant Human PTGR1 Protein, GST-tagged | +Inquiry |
PTGR1-1936Z | Recombinant Zebrafish PTGR1 | +Inquiry |
PTGR1-2048H | Recombinant Full Length Human Prostaglandin Reductase 1 / PTGR1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTGR1-2708HCL | Recombinant Human PTGR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTGR1 Products
Required fields are marked with *
My Review for All PTGR1 Products
Required fields are marked with *
0
Inquiry Basket