Recombinant Human PTPRD protein, His-tagged
Cat.No. : | PTPRD-3759H |
Product Overview : | Recombinant Human PTPRD protein(1089-1225 aa), fused to His tag, was expressed in E. coli. |
Availability | July 03, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1089-1225 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | GNSAGGLQHRVTAKTAPDVLRTKPAFIGKTNLDGMITVQLPEVPANENIKGYYIIIVPLKKSRGKFIKPWESPDEMELDELLKEISRKRRSIRYGREVELKPYIAAHFDVLPTEFTLGDDKHYGGFTNKQLQSGQEY |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PTPRD protein tyrosine phosphatase, receptor type, D [ Homo sapiens ] |
Official Symbol | PTPRD |
Synonyms | PTPRD; protein tyrosine phosphatase, receptor type, D; receptor-type tyrosine-protein phosphatase delta; HPTP; PTPD; R-PTP-delta; protein-tyrosine phosphatase delta; protein tyrosine phosphatase, receptor type, delta polypeptide; HPTPD; HPTPDELTA; RPTPDELTA; MGC119750; MGC119751; MGC119752; MGC119753; |
Gene ID | 5789 |
mRNA Refseq | NM_001040712 |
Protein Refseq | NP_001035802 |
MIM | 601598 |
UniProt ID | P23468 |
◆ Recombinant Proteins | ||
PTPRD-2060H | Recombinant Human PTPRD, GST-tagged | +Inquiry |
PTPRD-3759H | Recombinant Human PTPRD protein, His-tagged | +Inquiry |
PTPRD-36H | Recombinant Human PTPRD protein, His-tagged | +Inquiry |
PTPRD-807H | Recombinant Full Length Human PTPRD Protein, Untagged | +Inquiry |
PTPRD-2642H | Recombinant Human PTPRD Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTPRD-2678HCL | Recombinant Human PTPRD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTPRD Products
Required fields are marked with *
My Review for All PTPRD Products
Required fields are marked with *