Recombinant Human PTPRZ1 Protein (36-300 aa), His-SUMO-tagged

Cat.No. : PTPRZ1-756H
Product Overview : Recombinant Human PTPRZ1 Protein (36-300 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 36-300 aa
Description : Protein tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the bryonic spinal cord. Required for normal differentiation of the precursor cells into mature, fully myelinating oligodendrocytes. May play a role in protecting oligondendrocytes against apoptosis. May play a role in the establishment of contextual mory, probably via the dephosphorylation of proteins that are part of important signaling cascades.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 46.1 kDa
AA Sequence : IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name PTPRZ1 protein tyrosine phosphatase, receptor-type, Z polypeptide 1 [ Homo sapiens ]
Official Symbol PTPRZ1
Synonyms PTPRZ1; PTPRZ, PTPZ; phosphacan; PTP18; RPTPB; PTPZ; HPTPZ; PTPRZ; HPTPzeta; PTP-ZETA; RPTPbeta;
Gene ID 5803
mRNA Refseq NM_001206838
Protein Refseq NP_001193767
MIM 176891
UniProt ID P23471

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTPRZ1 Products

Required fields are marked with *

My Review for All PTPRZ1 Products

Required fields are marked with *

0
cart-icon
0
compare icon