Recombinant Human PVRL2 protein, T7/His-tagged
Cat.No. : | PVRL2-40H |
Product Overview : | Recombinant human CD112 extracellular domain cDNA (32 - 350 aa, Isoform-a, derived from BC003091) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 32-350 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEQDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPAN HQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGM TWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPS GRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTF PTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETP |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro cell receptors interaction for hematopoietic, endothelial differentiation regulations study coating with this protein.2. May be used for protein-protein interaction assay development.3. Potential diagnostic biomarker protein for acute myeloid leukemia.4. As antigen for specific antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | PVRL2 poliovirus receptor-related 2 (herpesvirus entry mediator B) [ Homo sapiens ] |
Official Symbol | PVRL2 |
Synonyms | PVRL2; poliovirus receptor-related 2 (herpesvirus entry mediator B); HVEB; poliovirus receptor-related protein 2; CD112; PRR2; PVRR2; nectin-2; poliovirus receptor-like 2; herpesvirus entry protein B; |
Gene ID | 5819 |
mRNA Refseq | NM_001042724 |
Protein Refseq | NP_001036189 |
MIM | 600798 |
UniProt ID | Q92692 |
Chromosome Location | 19q13.2-q13.4 |
Pathway | Adaptive Immune System, organism-specific biosystem; Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Adherens junctions interactions, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; |
Function | cell adhesion molecule binding; coreceptor activity; protein binding; protein homodimerization activity; protein homodimerization activity; receptor activity; |
◆ Recombinant Proteins | ||
PVRL2-611H | Active Recombinant Human PVRL2 Protein, Fc-Avi-tagged, Biotinylated | +Inquiry |
PVRL2-0572H | Active Recombinant Human PVRL2 protein, Fc-tagged | +Inquiry |
PVRL2-4653H | Recombinant Human PVRL2 protein, His-tagged | +Inquiry |
PVRL2-612H | Active Recombinant Human PVRL2 protein, His-Avi-tagged, Biotinylated | +Inquiry |
PVRL2-610H | Recombinant Human PVRL2 protein(Met1-Leu360) | +Inquiry |
◆ Cell & Tissue Lysates | ||
PVRL2-1403RCL | Recombinant Rat PVRL2 cell lysate | +Inquiry |
PVRL2-2647MCL | Recombinant Mouse PVRL2 cell lysate | +Inquiry |
PVRL2-3010HCL | Recombinant Human PVRL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PVRL2 Products
Required fields are marked with *
My Review for All PVRL2 Products
Required fields are marked with *
0
Inquiry Basket