Recombinant Human PYCARD protein(1-93aa), His-tagged
Cat.No. : | PYCARD-6130H |
Product Overview : | Recombinant Human PYCARD protein(Q9ULZ3)(1-93aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-93aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 14.3 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGS |
Gene Name | PYCARD PYD and CARD domain containing [ Homo sapiens ] |
Official Symbol | PYCARD |
Synonyms | PYCARD; PYD and CARD domain containing; apoptosis-associated speck-like protein containing a CARD; ASC; CARD5; TMS 1; target of methylation-induced silencing 1; caspase recruitment domain-containing protein 5; TMS; TMS1; TMS-1; MGC10332; |
Gene ID | 29108 |
mRNA Refseq | NM_013258 |
Protein Refseq | NP_037390 |
MIM | 606838 |
UniProt ID | Q9ULZ3 |
◆ Recombinant Proteins | ||
PYCARD-8966M | Recombinant Mouse PYCARD protein, His-tagged | +Inquiry |
PYCARD-080H | Recombinant Human PYCARD Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
PYCARD-86HFL | Recombinant Full Length Human PYCARD Protein, C-Flag-tagged | +Inquiry |
PYCARD-6130H | Recombinant Human PYCARD protein(1-93aa), His-tagged | +Inquiry |
PYCARD-3535R | Recombinant Rhesus Macaque PYCARD Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PYCARD-2648HCL | Recombinant Human PYCARD 293 Cell Lysate | +Inquiry |
PYCARD-2650HCL | Recombinant Human PYCARD 293 Cell Lysate | +Inquiry |
PYCARD-2649HCL | Recombinant Human PYCARD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PYCARD Products
Required fields are marked with *
My Review for All PYCARD Products
Required fields are marked with *
0
Inquiry Basket