Recombinant Human PYY protein, GST-tagged
Cat.No. : | PYY-3397H |
Product Overview : | Recombinant Human PYY protein(P10082)(31-64aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 31-64aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 31.1 kDa |
AA Sequence : | IKPEAPREDASPEELNRYYASLRHYLNLVTRQRY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PYY peptide YY [ Homo sapiens ] |
Official Symbol | PYY |
Synonyms | PYY; peptide YY; PYY1; PYY-I; peptide tyrosine tyrosine; |
Gene ID | 5697 |
mRNA Refseq | NM_004160 |
Protein Refseq | NP_004151 |
UniProt ID | P10082 |
◆ Recombinant Proteins | ||
Pyy-1457R | Recombinant Rat Pyy protein, His & T7-tagged | +Inquiry |
PYY-2088H | Recombinant Human PYY, His-tagged | +Inquiry |
PYY-417HF | Recombinant Full Length Human PYY Protein | +Inquiry |
PYY-370H | Recombinant Human PYY Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
PYY-2831H | Recombinant Human PYY Protein, His-tagged, OVA Conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
PYY-2641HCL | Recombinant Human PYY 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PYY Products
Required fields are marked with *
My Review for All PYY Products
Required fields are marked with *