Recombinant Human PYY Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | PYY-370H |
Product Overview : | PYY MS Standard C13 and N15-labeled recombinant protein (NP_004151) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the neuropeptide Y (NPY) family of peptides. The encoded preproprotein is proteolytically processed to generate two alternative peptide products that differ in length by three amino acids. These peptides, secreted by endocrine cells in the gut, exhibit different binding affinities for each of the neuropeptide Y receptors. Binding of the encoded peptides to these receptors mediates regulation of pancreatic secretion, gut mobility and energy homeostasis. Rare variations in this gene could increase susceptibility to obesity and elevated serum levels of the encoded peptides may be associated with anorexia nervosa. [provided by RefSeq, Feb 2016] |
Molecular Mass : | 11.1 kDa |
AA Sequence : | MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLWTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PYY peptide YY [ Homo sapiens (human) ] |
Official Symbol | PYY |
Synonyms | PYY; peptide YY; PYY1; PYY-I; peptide tyrosine tyrosine; |
Gene ID | 5697 |
mRNA Refseq | NM_004160 |
Protein Refseq | NP_004151 |
MIM | 600781 |
UniProt ID | P10082 |
◆ Recombinant Proteins | ||
PYY-29935TH | Recombinant Full Length Human PYY Protein, GST tagged | +Inquiry |
PYY-2088H | Recombinant Human PYY, His-tagged | +Inquiry |
PYY-5507H | Recombinant Human PYY protein, His-tagged | +Inquiry |
PYY-417HF | Recombinant Full Length Human PYY Protein | +Inquiry |
PYY-3398H | Recombinant Human PYY protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PYY-2641HCL | Recombinant Human PYY 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PYY Products
Required fields are marked with *
My Review for All PYY Products
Required fields are marked with *
0
Inquiry Basket