Recombinant Human PYY Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : PYY-370H
Product Overview : PYY MS Standard C13 and N15-labeled recombinant protein (NP_004151) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the neuropeptide Y (NPY) family of peptides. The encoded preproprotein is proteolytically processed to generate two alternative peptide products that differ in length by three amino acids. These peptides, secreted by endocrine cells in the gut, exhibit different binding affinities for each of the neuropeptide Y receptors. Binding of the encoded peptides to these receptors mediates regulation of pancreatic secretion, gut mobility and energy homeostasis. Rare variations in this gene could increase susceptibility to obesity and elevated serum levels of the encoded peptides may be associated with anorexia nervosa. [provided by RefSeq, Feb 2016]
Molecular Mass : 11.1 kDa
AA Sequence : MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLWTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PYY peptide YY [ Homo sapiens (human) ]
Official Symbol PYY
Synonyms PYY; peptide YY; PYY1; PYY-I; peptide tyrosine tyrosine;
Gene ID 5697
mRNA Refseq NM_004160
Protein Refseq NP_004151
MIM 600781
UniProt ID P10082

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PYY Products

Required fields are marked with *

My Review for All PYY Products

Required fields are marked with *

0
cart-icon
0
compare icon