Recombinant Human QARS, His-tagged

• Cat.No.: QARS-28669TH
• Product Overview: Recombinant fragment, corresponding to amino acids 434-772 of Human QARS with N terminal His tag; 339 amino acids, 39kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 434-772 a.a.
• Description: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. In metazoans, 9 aminoacyl-tRNA synthetases specific for glutamine (gln), glutamic acid (glu), and 7 other amino acids are associated within a multienzyme complex. Although present in eukaryotes, glutaminyl-tRNA synthetase (QARS) is absent from many prokaryotes, mitochondria, and chloroplasts, in which Gln-tRNA(Gln) is formed by transamidation of the misacylated Glu-tRNA(Gln). Glutaminyl-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 119 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: IYPTYDYTHCLCDSIEHITHSLCTKEFQARRSSYFWLCNA LDVYCPVQWEYGRLNLHYAVVSKRKILQLVATGAVRDW DDPRLFTLTALRRRGFPPEAINNFCARVGVTVAQTTMEPHLLEACVRDVLNDTAPRAMAVLESLRVIITNFPAAKSLD IQVPNFPADETKGFHQVPFAPIVFIERTDFKEEPEPGF KRLAWGQPVGLRHTGYVIELQHVVKGPSGCVESLEVTCRRADAGEKPKAFIHWVSQPLMCEVRLYERLFQHKNPEDPT EVPGGFLSDLNLASLHVVDAALVDCSVALAKPFDKFQF ERLGYFSVDPDSHQGKLVFNRTVTLKEDP

Gene Information

• Gene Name: QARS glutaminyl-tRNA synthetase [ Homo sapiens ]
• Official Symbol: QARS
• Synonyms: QARS; glutaminyl-tRNA synthetase; glutamine tRNA ligase
• Gene ID: 5859
• mRNA Refseq: NM_005051
• Protein Refseq: NP_005042
• MIM: 603727
• Uniprot ID: P47897
• Chromosome Location: 3p21.31
• Pathway: Aminoacyl-tRNA biosynthesis, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, conserved biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, conserved biosystem; Cytosolic tRNA aminoacylation, organism-specific biosystem
• Function: ATP binding; glutamine-tRNA ligase activity; ligase activity; nucleotide binding