Recombinant Human DFFB Protein(1-341aa), GST-tagged

• Cat.No.: QKI-2091H
• Product Overview: Recombinant Human DFFB Protein(1-341aa)(Q96PU8), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-341aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 64.7kDa
• AA Sequence: MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: QKI QKI, KH domain containing, RNA binding [ Homo sapiens ]
• Official Symbol: QKI
• Synonyms: QKI; QKI, KH domain containing, RNA binding; quaking homolog, KH domain RNA binding (mouse); protein quaking; QK3; RNA binding protein HQK; quaking homolog, KH domain RNA binding; homolog of mouse quaking QKI (KH domain RNA binding protein); QK; Hqk; QK1; hqkI; DKFZp586I0923
• Gene ID: 9444
• mRNA Refseq: NM_006775
• Protein Refseq: NP_006766
• MIM: 609590
• UniProt ID: Q96PU8