Recombinant Human RAB21 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RAB21-3903H
Product Overview : RAB21 MS Standard C13 and N15-labeled recombinant protein (NP_055814) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene belongs to the Rab family of monomeric GTPases, which are involved in the control of cellular membrane traffic. The encoded protein plays a role in the targeted trafficking of integrins via its association with integrin alpha tails. As a consequence, the encoded protein is involved in the regulation of cell adhesion and migration. Expression of this gene is associated with a poor prognosis for glioma patients. This gene is downregulated by the tumor suppressor miR-200b, and miRNA-200b is itself downregulated in glioma tissues.
Molecular Mass : 24.3 kDa
AA Sequence : MAAAGGGGGGAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGGCCSSGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RAB21 RAB21, member RAS oncogene family [ Homo sapiens (human) ]
Official Symbol RAB21
Synonyms RAB21; RAB21, member RAS oncogene family; ras-related protein Rab-21; KIAA0118;
Gene ID 23011
mRNA Refseq NM_014999
Protein Refseq NP_055814
MIM 612398
UniProt ID Q9UL25

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAB21 Products

Required fields are marked with *

My Review for All RAB21 Products

Required fields are marked with *

0
cart-icon
0
compare icon