Recombinant Human RAB35 protein(1-201aa), His-GST-tagged
| Cat.No. : | RAB35-2146H |
| Product Overview : | Recombinant Human RAB35 protein(Q15286)(1-201aa), fused with N-terminal His and GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST&His |
| Protein Length : | 1-201aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 54.6 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC |
| Gene Name | RAB35 RAB35, member RAS oncogene family [ Homo sapiens ] |
| Official Symbol | RAB35 |
| Synonyms | RAB35; RAB35, member RAS oncogene family; ras-related protein Rab-35; H ray; GTP-binding protein RAY; ras-related protein rab-1c (GTP-binding protein ray); RAY; H-ray; RAB1C; |
| Gene ID | 11021 |
| mRNA Refseq | NM_001167606 |
| Protein Refseq | NP_001161078 |
| MIM | 604199 |
| UniProt ID | Q15286 |
| ◆ Recombinant Proteins | ||
| RAB35-1832H | Recombinant Human RAB35 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RAB35-2116H | Recombinant Full Length Human RAB35 Protein, GST-tagged | +Inquiry |
| RAB35-6869H | Recombinant Human RAB35, Member RAS Oncogene Family, His-tagged | +Inquiry |
| RAB35-2978H | Recombinant Human RAB35 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RAB35-4547R | Recombinant Rat RAB35 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RAB35-2604HCL | Recombinant Human RAB35 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB35 Products
Required fields are marked with *
My Review for All RAB35 Products
Required fields are marked with *
