Recombinant Human RAB35 protein(1-201aa), His-GST-tagged

Cat.No. : RAB35-2146H
Product Overview : Recombinant Human RAB35 protein(Q15286)(1-201aa), fused with N-terminal His and GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST&His
Protein Length : 1-201aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 54.6 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC
Gene Name RAB35 RAB35, member RAS oncogene family [ Homo sapiens ]
Official Symbol RAB35
Synonyms RAB35; RAB35, member RAS oncogene family; ras-related protein Rab-35; H ray; GTP-binding protein RAY; ras-related protein rab-1c (GTP-binding protein ray); RAY; H-ray; RAB1C;
Gene ID 11021
mRNA Refseq NM_001167606
Protein Refseq NP_001161078
MIM 604199
UniProt ID Q15286

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAB35 Products

Required fields are marked with *

My Review for All RAB35 Products

Required fields are marked with *

0
cart-icon
0
compare icon