Recombinant Human RAB7B Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RAB7B-2398H |
Product Overview : | RAB7B MS Standard C13 and N15-labeled recombinant protein (NP_796377) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Controls vesicular trafficking from endosomes to the trans-Golgi network (TGN). Acts as a negative regulator of TLR9 signaling and can suppress TLR9-triggered TNFA, IL6, and IFNB production in macrophages by promoting TLR9 lysosomal degradation. Also negatively regulates TLR4 signaling in macrophages by promoting lysosomal degradation of TLR4. Promotes megakaryocytic differentiation by increasing NF-kappa-B-dependent IL6 production and subsequently enhancing the association of STAT3 with GATA1. Not involved in the regulation of the EGF- and EGFR degradation pathway. |
Molecular Mass : | 22.5 kDa |
AA Sequence : | MNPRKKVDLKLIIVGAIGVGKTSLLHQYVHKTFYEEYQTTLGASILSKIIILGDTTLKLQIWDTGGQERFRSMVSTFYKGSDGCILAFDVTDLESFEALDIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RAB7B RAB7B, member RAS oncogene family [ Homo sapiens (human) ] |
Official Symbol | RAB7B |
Synonyms | RAB7B; RAB7B, member RAS oncogene family; ras-related protein Rab-7b; MGC9726; MGC16212; Ras-related protein Rab-7; RAB7; |
Gene ID | 338382 |
mRNA Refseq | NM_177403 |
Protein Refseq | NP_796377 |
UniProt ID | Q96AH8 |
◆ Recombinant Proteins | ||
RAB7B-2133H | Recombinant Human RAB7B, GST-tagged | +Inquiry |
RAB7B-5676HFL | Recombinant Full Length Human RAB7B, Flag-tagged | +Inquiry |
RAB7B-193H | Recombinant Human RAB7B, MYC/DDK-tagged | +Inquiry |
Rab7b-5331M | Recombinant Mouse Rab7b Protein, Myc/DDK-tagged | +Inquiry |
RAB7B-195H | Recombinant Human RAB7B, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB7B-2582HCL | Recombinant Human RAB7B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB7B Products
Required fields are marked with *
My Review for All RAB7B Products
Required fields are marked with *