Recombinant Human RAB8A protein, GST-tagged
Cat.No. : | RAB8A-2135H |
Product Overview : | Recombinant Human RAB8A protein(31-194 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | August 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 31-194 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | DAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | RAB8A RAB8A, member RAS oncogene family [ Homo sapiens ] |
Official Symbol | RAB8A |
Synonyms | RAB8A; RAB8A, member RAS oncogene family; MEL, mel transforming oncogene (derived from cell line NK14); ras-related protein Rab-8A; RAB8; oncogene c-mel; ras-associated protein RAB8; mel transforming oncogene (RAB8 homolog); mel transforming oncogene (derived from cell line NK14); mel transforming oncogene (derived from cell line NK14)- RAB8 homolog; MEL; |
Gene ID | 4218 |
mRNA Refseq | NM_005370 |
Protein Refseq | NP_005361 |
MIM | 165040 |
UniProt ID | P61006 |
◆ Recombinant Proteins | ||
RAB8A-037H | Recombinant Human RAB8A Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
RAB8A-3150C | Recombinant Chicken RAB8A | +Inquiry |
RAB8A-13839M | Recombinant Mouse RAB8A Protein | +Inquiry |
Rab8a-5332M | Recombinant Mouse Rab8a Protein, Myc/DDK-tagged | +Inquiry |
RAB8A-5636Z | Recombinant Zebrafish RAB8A | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB8A-2580HCL | Recombinant Human RAB8A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB8A Products
Required fields are marked with *
My Review for All RAB8A Products
Required fields are marked with *