Recombinant Full Length Human RAB8A Protein, C-Flag-tagged
Cat.No. : | RAB8A-285HFL |
Product Overview : | Recombinant Full Length Human RAB8A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the RAS superfamily which are small GTP/GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB/YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. This protein shares 97%, 96%, and 51% similarity with the dog RAB8, mouse MEL, and mouse YPT1 proteins, respectively and contains the 4 GTP/GDP-binding sites that are present in all the RAS proteins. The putative effector-binding site of this protein is similar to that of the RAB/YPT proteins. However, this protein contains a C-terminal CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignant melanoma has been demonstrable. This oncogene is located 800 kb distal to MY09B on chromosome 19p13.1. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 23.5 kDa |
AA Sequence : | MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERF RTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLA LDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Full Length : | Full L. |
Gene Name | RAB8A RAB8A, member RAS oncogene family [ Homo sapiens (human) ] |
Official Symbol | RAB8A |
Synonyms | MEL; RAB8 |
Gene ID | 4218 |
mRNA Refseq | NM_005370.5 |
Protein Refseq | NP_005361.2 |
MIM | 165040 |
UniProt ID | P61006 |
◆ Recombinant Proteins | ||
RAB8A-839C | Recombinant Cynomolgus RAB8A Protein, His-tagged | +Inquiry |
RAB8A-392H | Recombinant Human RAB8A protein, His-tagged | +Inquiry |
RAB8A-29054TH | Recombinant Human RAB8A | +Inquiry |
RAB8A-1841H | Recombinant Human RAB8A Protein, His (Fc)-Avi-tagged | +Inquiry |
Rab8a-5332M | Recombinant Mouse Rab8a Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB8A-2580HCL | Recombinant Human RAB8A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAB8A Products
Required fields are marked with *
My Review for All RAB8A Products
Required fields are marked with *
0
Inquiry Basket