Recombinant Human RAB8A Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : RAB8A-037H
Product Overview : RAB8A MS Standard C13 and N15-labeled recombinant protein (NP_005361) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a member of the RAS superfamily which are small GTP/GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB/YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. This protein shares 97%, 96%, and 51% similarity with the dog RAB8, mouse MEL, and mouse YPT1 proteins, respectively and contains the 4 GTP/GDP-binding sites that are present in all the RAS proteins. The putative effector-binding site of this protein is similar to that of the RAB/YPT proteins. However, this protein contains a C-terminal CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignant melanoma has been demonstrable. This oncogene is located 800 kb distal to MY09B on chromosome 19p13.1.
Molecular Mass : 23.7 kDa
AA Sequence : MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RAB8A RAB8A, member RAS oncogene family [ Homo sapiens (human) ]
Official Symbol RAB8A
Synonyms RAB8A; RAB8A, member RAS oncogene family; MEL; RAB8; ras-related protein Rab-8A; mel transforming oncogene (RAB8 homolog); mel transforming oncogene (derived from cell line NK14); mel transforming oncogene (derived from cell line NK14)- RAB8 homolog; oncogene c-mel; ras-associated protein RAB8
Gene ID 4218
mRNA Refseq NM_005370
Protein Refseq NP_005361
MIM 165040
UniProt ID P61006

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAB8A Products

Required fields are marked with *

My Review for All RAB8A Products

Required fields are marked with *

0
cart-icon
0
compare icon