Recombinant Human RABEPK protein, His-tagged
| Cat.No. : | RABEPK-3363H |
| Product Overview : | Recombinant Human RABEPK protein(1-372 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 18, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-372 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MKQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRGKVFIVGGANPNGSFSDVHTMDLGKHQWDLDTCKGLLPRYEHASFIPSCTPDRIWVFGGANQSGNRNCLQVLNPETRTWTTPEVTSPPPSPRTFHTSSAAIGNQLYVFGGGERGAQPVQDTKLHVFDANTLTWSQPETLGNPPSPRHGHVMVAAGTKLFIHGGLAGDRFYDDLHCIDISDMKWQKLNPTGAAPAGCAAHSAVAMGKHVYIFGGMTPAGALDTMYQYHTEEQHWTLLKFDTLLPPGRLDHSMCIIPWPVTCASEKEDSNSLTLNHEAEKEDSADKVMSHSGDSHEESQTATLLCLVFGGMNTEGEIYDDCIVTVVD |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | RABEPK Rab9 effector protein with kelch motifs [ Homo sapiens ] |
| Official Symbol | RABEPK |
| Synonyms | RABEPK; Rab9 effector protein with kelch motifs; rab9 effector protein with kelch motifs; bA65N13.1; RAB9P40; Rab9 effector p40; 40 kDa Rab9 effector protein; p40; DKFZp686P1077; |
| Gene ID | 10244 |
| mRNA Refseq | NM_001174152 |
| Protein Refseq | NP_001167623 |
| MIM | 605962 |
| UniProt ID | Q7Z6M1 |
| ◆ Recombinant Proteins | ||
| RABEPK-4563R | Recombinant Rat RABEPK Protein, His (Fc)-Avi-tagged | +Inquiry |
| RABEPK-3363H | Recombinant Human RABEPK protein, His-tagged | +Inquiry |
| RABEPK-7369M | Recombinant Mouse RABEPK Protein, His (Fc)-Avi-tagged | +Inquiry |
| RABEPK-301308H | Recombinant Human RABEPK protein, GST-tagged | +Inquiry |
| RABEPK-13846M | Recombinant Mouse RABEPK Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RABEPK-525HCL | Recombinant Human RABEPK lysate | +Inquiry |
| RABEPK-414HKCL | Human RABEPK Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RABEPK Products
Required fields are marked with *
My Review for All RABEPK Products
Required fields are marked with *
