Recombinant Human RAC1(Y72C) protein, His-tagged
| Cat.No. : | RAC1-193H |
| Product Overview : | Recombinant Human RAC1(Y72C) fused with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. Two transcript variants encoding different isoforms have been found for this gene. |
| Form : | 50mM Tris-HCl, pH 8.0, 200mMNaCl, 20% glycerol. |
| Molecular Mass : | (Theoretical molecular weight)~24kDa including His tag |
| AA Sequence : | MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSCPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP PVKKRKRKCLLL |
| Purity : | > 90% as determined by SDS-PAGE |
| Storage : | Short Term Storage at +4 centigrade, Long Term, please prepare aliquots and store at -20~-80 centigrade. Avoid freeze/thaw cycles. |
| Concentration : | 2.0mg/ml |
| Gene Name | RAC1 ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1) [ Homo sapiens ] |
| Official Symbol | RAC1 |
| Synonyms | RAC1; ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1); ras-related C3 botulinum toxin substrate 1; p21 Rac1; Rac 1; TC 25; ras-like protein TC25; cell migration-inducing gene 5 protein; MIG5; Rac-1; TC-25; p21-Rac1; MGC111543; |
| Gene ID | 5879 |
| mRNA Refseq | NM_006908 |
| Protein Refseq | NP_008839 |
| MIM | 602048 |
| UniProt ID | P63000 |
| Chromosome Location | 7p22 |
| Pathway | Activation of Rac, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; |
| Function | GTP binding; GTPase activity; enzyme binding; nucleotide binding; protein binding; thioesterase binding; |
| ◆ Recombinant Proteins | ||
| RAC1-189H | Recombinant Full Length Human Ras-related C3 Botulinum Toxin Substrate 1 / RAC1 Protein, Untagged | +Inquiry |
| RAC1-445H | Recombinant Human RAC1 Protein, MYC/DDK-tagged | +Inquiry |
| RAC1-1845H | Recombinant Human RAC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RAC1-4908R | Recombinant Rat RAC1 Protein | +Inquiry |
| RAC1-7379M | Recombinant Mouse RAC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RAC1-712HCL | Recombinant Human RAC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAC1 Products
Required fields are marked with *
My Review for All RAC1 Products
Required fields are marked with *
