Recombinant Human RAD17 Protein, His-tagged

Cat.No. : RAD17-2153H
Product Overview : Recombinant Human RAD17(431-681aa) fused with His tag was produced in E. coli.
Availability May 22, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 431-681aa
Description : The protein encoded by this gene is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs. This protein binds to chromatin prior to DNA damage and is phosphorylated by the checkpoint kinase ATR following damage. This protein recruits the RAD1-RAD9-HUS1 checkpoint protein complex onto chromatin after DNA damage, which may be required for its phosphorylation. The phosphorylation of this protein is required for the DNA-damage-induced cell cycle G2 arrest, and is thought to be a critical early event during checkpoint signaling in DNA-damaged cells. Multiple alternatively spliced transcript variants of this gene, which encode four distinct protein isoforms, have been reported. Two pseudogenes, located on chromosomes 7 and 13, have been identified.
Form : The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7. ) added with 300mM Imidazole and 15% glycerol.
AA sequence : SHMPGDLFNLYLHQNYIDFFMEIDDIVRASEFLSFADILSGDWNTRSLLREYSTSIATRGVMHSNKARGYAHCQGGGSSFRPLHKPQWFLINKKYRENCLAAKALFPDFCLPALCRQTQLLPYLALLTIPMRNQAQISFIQDIGRLPLKRHFGRLKMEALTDREHGMIDPDSGDEAQLNGGHSAEESLGEPTQATVPETWSLPLSQNSASELPASQPQPFSAQGDMEENIIIEDYESDGT
Storage : Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
Shipping : The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.
Gene Name RAD17 RAD17 homolog (S. pombe) [ Homo sapiens ]
Official Symbol RAD17
Synonyms RAD17; RAD17 homolog (S. pombe); RAD1 (S. pombe) homolog; cell cycle checkpoint protein RAD17; CCYC; RAD17Sp; Rad24; RAD1 homolog; Rad17-like protein; RF-C activator 1 homolog; RF-C/activator 1 homolog; cell cycle checkpoint protein (RAD17); R24L; RAD24; HRAD17; RAD17SP; FLJ41520;
Gene ID 5884
mRNA Refseq NM_002873
Protein Refseq NP_002864
MIM 603139
UniProt ID O75943

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RAD17 Products

Required fields are marked with *

My Review for All RAD17 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon