Recombinant Human RAMP1 Protein, His&Avi tagged, Biotinylated

• Cat.No.: RAMP1-3965H
• Product Overview: Biotinylated recombinant Human RAMP1 Protein (27-116 aa) with His&Avi tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Avi&His
• Protein Length: 27-116 aa
• Conjugation/Label: Biotin
• Description: The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytoplasmic C terminus. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a receptor with seven transmembrane domains, can function as either a calcitonin-gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. In the presence of this (RAMP1) protein, CRLR functions as a CGRP receptor. The RAMP1 protein is involved in the terminal glycosylation, maturation, and presentation of the CGRP receptor to the cell surface. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Molecular Mass: 14 kDa
• AASequence: CQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGGGGSGGGSHHHHHHHHGLNDIFEAQKIEWHE
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.24 mg/mL by BCA
• Storage Buffer: Sterile PBS, pH7.4, 0.1% SKL, 8% Trehalose, 5% Glycerol
• Labeling Efficiency: 1.1 by HABA

Gene Information

• Gene Name: RAMP1 receptor (G protein-coupled) activity modifying protein 1 [ Homo sapiens (human) ]
• Official Symbol: RAMP1
• Synonyms: RAMP1; receptor (G protein-coupled) activity modifying protein 1; receptor (calcitonin) activity modifying protein 1 , receptor activity modifying protein 1; receptor activity-modifying protein 1; CRLR activity-modifying protein 1; receptor activity modifying protein 1; receptor (calcitonin) activity modifying protein 1; calcitonin receptor-like receptor activity modifying protein 1; calcitonin-receptor-like receptor activity-modifying protein 1
• Gene ID: 10267
• mRNA Refseq: NM_005855
• Protein Refseq: NP_005846
• MIM: 605153
• UniProt ID: O60894

Q&As

Dear You mentionne in this product a FC part, but it is not clear. Does this construction contain a Fc fragment (human or murine ?).

Many thanks for your interest in our products. This protein will be produced upon order. You can decide the sequence of this Fc tag.