Recombinant Human RAMP1 Protein, His&Avi tagged, Biotinylated

Cat.No. : RAMP1-3965H
Product Overview : Biotinylated recombinant Human RAMP1 Protein (27-116 aa) with His&Avi tag was expressed in HEK293.
Availability February 03, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Avi&His
Protein Length : 27-116 aa
Conjugation/Label : Biotin
Description : The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytoplasmic C terminus. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a receptor with seven transmembrane domains, can function as either a calcitonin-gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. In the presence of this (RAMP1) protein, CRLR functions as a CGRP receptor. The RAMP1 protein is involved in the terminal glycosylation, maturation, and presentation of the CGRP receptor to the cell surface. Alternative splicing results in multiple transcript variants encoding different isoforms.
Molecular Mass : 14 kDa
AASequence : CQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGGGGSGGGSHHHHHHHHGLNDIFEAQKIEWHE
Endotoxin : < 1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.24 mg/mL by BCA
Storage Buffer : Sterile PBS, pH7.4, 0.1% SKL, 8% Trehalose, 5% Glycerol
Labeling Efficiency : 1.1 by HABA
Gene Name RAMP1 receptor (G protein-coupled) activity modifying protein 1 [ Homo sapiens (human) ]
Official Symbol RAMP1
Synonyms RAMP1; receptor (G protein-coupled) activity modifying protein 1; receptor (calcitonin) activity modifying protein 1 , receptor activity modifying protein 1; receptor activity-modifying protein 1; CRLR activity-modifying protein 1; receptor activity modifying protein 1; receptor (calcitonin) activity modifying protein 1; calcitonin receptor-like receptor activity modifying protein 1; calcitonin-receptor-like receptor activity-modifying protein 1
Gene ID 10267
mRNA Refseq NM_005855
Protein Refseq NP_005846
MIM 605153
UniProt ID O60894

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (1)

Customer Reviews

Write a review

Q&As

Ask a question

Dear You mentionne in this product a FC part, but it is not clear. Does this construction contain a Fc fragment (human or murine ?). RAMP1-3965H 05/27/2024

Many thanks for your interest in our products. This protein will be produced upon order. You can decide the sequence of this Fc tag.

Ask a Question for All RAMP1 Products

Required fields are marked with *

My Review for All RAMP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon