Recombinant Human RANBP1 protein, GST-tagged
| Cat.No. : | RANBP1-301411H |
| Product Overview : | Recombinant Human RANBP1 (220-278 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Leu220-Gln278 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MLNAENAQKFKTKFEECRKEIEEREKKAGSGKNDHAEKVAEKLEALSVKEETKEDAEEKQ |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | RANBP1 RAN binding protein 1 [ Homo sapiens ] |
| Official Symbol | RANBP1 |
| Synonyms | RANBP1; RAN binding protein 1; ran-specific GTPase-activating protein; HTF9A; ran-binding protein 1; MGC88701; |
| Gene ID | 5902 |
| mRNA Refseq | NM_002882 |
| Protein Refseq | NP_002873 |
| MIM | 601180 |
| UniProt ID | P43487 |
| ◆ Recombinant Proteins | ||
| RANBP1-30900TH | Recombinant Human RANBP1 | +Inquiry |
| RANBP1-4717H | Recombinant Human RANBP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RANBP1-426HF | Recombinant Full Length Human RANBP1 Protein | +Inquiry |
| ranbp1-321X | Active Recombinant Xenopus laevis ranbp1 protein, His-tagged | +Inquiry |
| RANBP1-301411H | Recombinant Human RANBP1 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RANBP1-2534HCL | Recombinant Human RANBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RANBP1 Products
Required fields are marked with *
My Review for All RANBP1 Products
Required fields are marked with *




