Recombinant Human RANBP1 protein, GST-tagged
Cat.No. : | RANBP1-301411H |
Product Overview : | Recombinant Human RANBP1 (220-278 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Leu220-Gln278 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MLNAENAQKFKTKFEECRKEIEEREKKAGSGKNDHAEKVAEKLEALSVKEETKEDAEEKQ |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | RANBP1 RAN binding protein 1 [ Homo sapiens ] |
Official Symbol | RANBP1 |
Synonyms | RANBP1; RAN binding protein 1; ran-specific GTPase-activating protein; HTF9A; ran-binding protein 1; MGC88701; |
Gene ID | 5902 |
mRNA Refseq | NM_002882 |
Protein Refseq | NP_002873 |
MIM | 601180 |
UniProt ID | P43487 |
◆ Recombinant Proteins | ||
Ranbp1-5365M | Recombinant Mouse Ranbp1 Protein, Myc/DDK-tagged | +Inquiry |
RANBP1-443H | Recombinant Human RANBP1 Protein, His-tagged | +Inquiry |
RANBP1-3598R | Recombinant Rhesus Macaque RANBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RANBP1-7412M | Recombinant Mouse RANBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RANBP1-1332C | Recombinant Chicken RANBP1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RANBP1-2534HCL | Recombinant Human RANBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RANBP1 Products
Required fields are marked with *
My Review for All RANBP1 Products
Required fields are marked with *
0
Inquiry Basket