Recombinant Human RANBP2 Protein (2601-2802 aa), His-tagged
Cat.No. : | RANBP2-2250H |
Product Overview : | Recombinant Human RANBP2 Protein (2601-2802 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 2601-2802 aa |
Description : | E3 SUMO-protein ligase which facilitates SUMO1 and SUMO2 conjugation by UBE2I. Involved in transport factor (Ran-GTP, karyopherin)-mediated protein import via the F-G repeat-containing domain which acts as a docking site for substrates. Binds single-stranded RNA (in vitro). May bind DNA. Component of the nuclear export pathway. Specific docking site for the nuclear export factor exportin-1. Sumoylates PML at 'Lys-490' which is essential for the proper assembly of PML-NB. Recruits BICD2 to the nuclear envelope and cytoplasmic stacks of nuclear pore complex known as annulate lamellae during G2 phase of cell cycle. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 24.8 kDa |
AA Sequence : | PTEESSINYTFKTPEKAKEKKKPEDSPSDDDVLIVYELTPTAEQKALATKLKLPPTFFCYKNRPDYVSEEEEDDEDFETAVKKLNGKLYLDGSEKCRPLEENTADNEKECIIVWEKKPTVEEKAKADTLKLPPTFFCGVCSDTDEDNGNGEDFQSELQKVQEAQKSQTEEITSTTDSVYTGGTEVMVPSFCKSEEPDSITKS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | RANBP2 RAN binding protein 2 [ Homo sapiens ] |
Official Symbol | RANBP2 |
Synonyms | RANBP2; NUP358; P270; nucleoporin 358; nucleoporin Nup358; 358 kDa nucleoporin; ANE1; TRP1; TRP2; IIAE3; |
Gene ID | 5903 |
mRNA Refseq | NM_006267 |
Protein Refseq | NP_006258 |
MIM | 601181 |
UniProt ID | P49792 |
◆ Recombinant Proteins | ||
RANBP2-7414M | Recombinant Mouse RANBP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RANBP2-2386H | Active Recombinant Human RANBP2 Protein, GST-tagged | +Inquiry |
RANBP2-13912M | Recombinant Mouse RANBP2 Protein | +Inquiry |
RANBP2-3410H | Recombinant Human RANBP2 protein, His-B2M-tagged | +Inquiry |
RANBP2-2250H | Recombinant Human RANBP2 Protein (2601-2802 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RANBP2 Products
Required fields are marked with *
My Review for All RANBP2 Products
Required fields are marked with *
0
Inquiry Basket