Recombinant Human RANBP2 Protein (2601-2802 aa), His-tagged

Cat.No. : RANBP2-2250H
Product Overview : Recombinant Human RANBP2 Protein (2601-2802 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 2601-2802 aa
Description : E3 SUMO-protein ligase which facilitates SUMO1 and SUMO2 conjugation by UBE2I. Involved in transport factor (Ran-GTP, karyopherin)-mediated protein import via the F-G repeat-containing domain which acts as a docking site for substrates. Binds single-stranded RNA (in vitro). May bind DNA. Component of the nuclear export pathway. Specific docking site for the nuclear export factor exportin-1. Sumoylates PML at 'Lys-490' which is essential for the proper assembly of PML-NB. Recruits BICD2 to the nuclear envelope and cytoplasmic stacks of nuclear pore complex known as annulate lamellae during G2 phase of cell cycle.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 24.8 kDa
AA Sequence : PTEESSINYTFKTPEKAKEKKKPEDSPSDDDVLIVYELTPTAEQKALATKLKLPPTFFCYKNRPDYVSEEEEDDEDFETAVKKLNGKLYLDGSEKCRPLEENTADNEKECIIVWEKKPTVEEKAKADTLKLPPTFFCGVCSDTDEDNGNGEDFQSELQKVQEAQKSQTEEITSTTDSVYTGGTEVMVPSFCKSEEPDSITKS
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name RANBP2 RAN binding protein 2 [ Homo sapiens ]
Official Symbol RANBP2
Synonyms RANBP2; NUP358; P270; nucleoporin 358; nucleoporin Nup358; 358 kDa nucleoporin; ANE1; TRP1; TRP2; IIAE3;
Gene ID 5903
mRNA Refseq NM_006267
Protein Refseq NP_006258
MIM 601181
UniProt ID P49792

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RANBP2 Products

Required fields are marked with *

My Review for All RANBP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon