Recombinant Human RAR related orphan receptor C protein, His tagged

• Cat.No.: RORC-01H
• Product Overview: Recombinant Human RORC protein (268-506aa) with N-His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 268-506aa
• Description: The protein encoded by this gene is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that this gene may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2. Two transcript variants encoding different isoforms have been found for this gene.
• Tag: N-His
• Molecular Mass: 30.2 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELF
• Purity: > 85% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: 20mM Tris, 0.5M NaCl, pH 8.0
• Concentration: 1.03 mg/mL

Gene Information

• Gene Name: RORC RAR related orphan receptor C [ Homo sapiens (human) ]
• Official Symbol: RORC
• Synonyms: RORC; RAR-related orphan receptor C; nuclear receptor ROR-gamma; NR1F3; RORG; RZRG; TOR; nuclear receptor RZR-gamma; retinoic acid-binding receptor gamma; retinoid-related orphan receptor gamma; RAR-related orphan receptor C, isoform a; RAR-related orphan nuclear receptor variant 2; nuclear receptor subfamily 1 group F member 3; RZR-GAMMA; MGC129539
• Gene ID: 6097
• mRNA Refseq: NM_001001523
• Protein Refseq: NP_001001523
• MIM: 602943
• UniProt ID: P51449