Recombinant Human RORC protein, GST-tagged

• Cat.No.: RORC-17H
• Product Overview: Recombinant Human RORC full-length ORF ( NP_005051.2, 1 a.a. - 518 a.a.) Protein, fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 84.6 kDa
• AA Sequence: MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPI DRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQGADTLTYT LGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLT PDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIF SREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRT VFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAF HHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: RORC RAR-related orphan receptor C [ Homo sapiens ]
• Official Symbol: RORC
• Synonyms: RORC; RAR-related orphan receptor C; nuclear receptor ROR-gamma; NR1F3; RORG; RZRG; TOR; nuclear receptor RZR-gamma; retinoic acid-binding receptor gamma; retinoid-related orphan receptor gamma; RAR-related orphan receptor C, isoform a; RAR-related orphan nuclear receptor variant 2; nuclear receptor subfamily 1 group F member 3; RZR-GAMMA; MGC129539
• Gene ID: 6097
• mRNA Refseq: NM_001001523
• Protein Refseq: NP_001001523
• MIM: 602943
• UniProt ID: P51449
• Chromosome Location: 1q21
• Pathway: Circadian rhythm - mammal, organism-specific biosystem; Circadian rhythm - mammal, conserved biosystem; Gene expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Nuclear Receptor transcription pathway, organism-specific biosystem
• Function: DNA binding; ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity; metal ion binding; receptor activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; steroid hormone receptor activity; zinc ion binding