Recombinant Human RARA protein, His-tagged
Cat.No. : | RARA-2840H |
Product Overview : | Recombinant Human RARA protein(83-424 aa), fused to His tag, was expressed in E. coli. |
Availability | September 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 83-424 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | RIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RARA retinoic acid receptor, alpha [ Homo sapiens ] |
Official Symbol | RARA |
Synonyms | RARA; retinoic acid receptor, alpha; retinoic acid receptor alpha; NR1B1; RAR; RAR-alpha; retinoic acid receptor, alpha polypeptide; nuclear receptor subfamily 1 group B member 1; retinoic acid nuclear receptor alpha variant 1; retinoic acid nuclear receptor alpha variant 2; nucleophosmin-retinoic acid receptor alpha fusion protein NPM-RAR long form; |
Gene ID | 5914 |
mRNA Refseq | NM_000964 |
Protein Refseq | NP_000955 |
MIM | 180240 |
UniProt ID | P10276 |
◆ Recombinant Proteins | ||
Rara-5686M | Recombinant Mouse Rara protein, His & T7-tagged | +Inquiry |
RARA-111H | Recombinant Human Retinoic acid receptor alpha, GST-tagged | +Inquiry |
RARA-31053TH | Recombinant Human RARA, His-tagged | +Inquiry |
RARA-301471H | Recombinant Human RARA protein, GST-tagged | +Inquiry |
RARA-15H | Recombinant Human RARA Protein, N-GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RARA-2516HCL | Recombinant Human RARA 293 Cell Lysate | +Inquiry |
RARA-2515HCL | Recombinant Human RARA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RARA Products
Required fields are marked with *
My Review for All RARA Products
Required fields are marked with *