Recombinant Human RARRES1

Cat.No. : RARRES1-31293TH
Product Overview : Recombinant fragment of Human RARRES1 with N terminal proprietary tag, 35.53kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 90 amino acids
Description : This gene was identified as a retinoid acid (RA) receptor-responsive gene. It encodes a type 1 membrane protein. The expression of this gene is upregulated by tazarotene as well as by retinoic acid receptors. The expression of this gene is found to be downregulated in prostate cancer, which is caused by the methylation of its promoter and CpG island. Alternatively spliced transcript variant encoding distinct isoforms have been observed.
Molecular Weight : 35.530kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : EMTTQVSHYYLAQLTSVRQWKTNDDTIDFDYTVLLHELSTQEIIPCRIHLVWYPGKPLKVKYHCQELQTPEEASGTEEGSAVVPTELSNF
Sequence Similarities : Belongs to the protease inhibitor I47 (latexin) family.
Gene Name RARRES1 retinoic acid receptor responder (tazarotene induced) 1 [ Homo sapiens ]
Official Symbol RARRES1
Synonyms RARRES1; retinoic acid receptor responder (tazarotene induced) 1; retinoic acid receptor responder protein 1; TIG1;
Gene ID 5918
mRNA Refseq NM_002888
Protein Refseq NP_002879
MIM 605090
Uniprot ID P49788
Chromosome Location 3q25.32

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RARRES1 Products

Required fields are marked with *

My Review for All RARRES1 Products

Required fields are marked with *

0
cart-icon